KEGG   Sus scrofa (pig): 100525416Help
Entry
100525416         CDS       T01009                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100525416 (ART1)
Cellular antigens [BR:ssc04090]
 Proteins
  100525416 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 326 aa AA seqDB search
MKTPAATCLLLVTMGLMAALQAQSHPITRRDLFSREMPLDMALASFDDQYAGCATAMTAA
LPDLNRTEFQANRVYADGWAQASSQWQERQAWGPGWGGSPSRLPPPPGFREEHGVALLAY
TANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLSSGQRPPQCHQVFRGV
QGLRFRPAGPGATVRLGGFASASLQNAAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEEV
LIPPFETFQVINASRPAQGPARIYLRALGKRSTYNCEYIKDKQCKSRPCRLDNSAMGRGP
LSALWSLLLLLWFLVGGAFPESPGLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccctgccgccacgtgtctgctgctggtgaccatgggccttatggcagcgctg
caggctcagagccaccccatcactcgacgagacctcttctctcgagaaatgcccctggac
atggccttggcctccttcgacgaccagtatgcgggctgtgccacagccatgacggctgct
ctcccggatctcaaccgcacggagttccaggccaacagagtgtacgcggacggctgggcg
caggccagcagccagtggcaggagcgccaggcctgggggccggggtggggcggcagccct
tcccgcctgcccccacccccaggctttcgagaagagcatggggtggccctcctggcttac
acggccaacagccccctgcacaaagaattcaacgcagccgtgcgcgaggcgggccgctcc
cgggcccactacctccaccacttctccttcaagacactgcacttcctgctgaccgaggcc
ctgcagctgctgagcagcgggcagcgtccaccgcagtgccaccaggtgttccgaggggtg
cagggcctgcgcttccggcccgcggggcccggggccaccgtcaggctgggcggcttcgcc
tctgcgtccctgcagaatgccgcggcccagcagtttggggaagacaccttctttggcatc
tggacctgcctcggggccccgatcaagggctactccttcttccccggggaggaggaggtg
ctgatccctcccttcgagaccttccaggtgatcaacgccagcaggccagcccagggccct
gcccgcatctacctgcgggccctgggcaagcggagcacctacaactgcgagtacatcaaa
gacaaacaatgcaagtctcgcccctgccgtctggataactcagctatgggtcggggcccc
ctttctgcactctggtcccttctactgctgctctggttccttgttgggggagcctttcca
gagagtccaggccttctctga

DBGET integrated database retrieval system