KEGG   Sus scrofa (pig): 100525616Help
Entry
100525616         CDS       T01009                                 

Gene name
AOX1
Definition
aldehyde oxidase 1
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100525616 (AOX1)
   00350 Tyrosine metabolism
    100525616 (AOX1)
   00380 Tryptophan metabolism
    100525616 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100525616 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    100525616 (AOX1)
   00830 Retinol metabolism
    100525616 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100525616 (AOX1)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100525616 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 1339 aa AA seqDB search
MPTIISFLLLTQVIERNADPEVTLLTFLRKKVRLTGTKYACGRGGCGACTVMVSKRDPVS
QKIRHFSVTACLVPICSLYGAAVTTVEGVGSIKTRLHPVQERLAKSHGTQCGFCTPGMVM
SMYALLRNHPQPSEEQLLAALGGNLCRCTGYRPILESGKTFCSESNGCQQKGTGKCCLDQ
GENDSASLDRKSDICTELFANEEFQPLDPTQELIFPPELLRMAENPEKRTLTFRGERVTW
ISPGTLKDLLELKVKYRDAPLIMGNTSLGPAMKSQGRFHPILLSPARISELSVVSKTSDG
LTIGAGCSLSQVNDILAESISELPEEKTQTYRALLKHLKSLAGQQIRNMASLGGHIISRH
CYSDLNPILTVGNTTLNLISEKGTRQIPLGEHFLAGLASADLKPGEILESVYIPHSRKWE
FVSAFRQAECQQNALADVNAGMRVLFRDGTDTVEDLSIAYGGVGAATVSAQKSCQQLLGR
RWDELLLDEACRLLLDEVSLPGWAPGGRVEFRRTLVVSFFFKFYLEVLQELKKGVEQFPV
PGTCRSPEISDGFLNALEDFPVTIPQGVQRYQSVDSHQPLQDPVGRPIMHLSGLKHATGE
AIFCDDIPMVDKELCMALVTSTRAHAKIISIDLSEALELPGVVDVIRAEDIPGTNGAEGD
KLLAVDEVLCVGQIICAVVAETDVQAKRASEKIKITYEELEPVIVTIEDAIKHNSFLCPE
KKLEQGNMEEAFENVDQIVEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVSTQDPAH
VQKTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGHPIRLVLDRED
DMLITGGRHPLFGKYKVGFMNSGRIKALDIECFINGGCMLDDSEQVTEFLILKLENAYKI
RNLRLRGRACLTHLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLLPEEVREKNMYKTVD
KTIYKQAFSPETLIRCWNECQDTSSFPSRRIQVEEFNKKNYWKKRGIAMIPMKFSVGFAA
SSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELRIPMSYLHICETSTATV
PNTIATAASIGSDVNGRAVQNACQILLKRLEPVIKKNPEGTWEDWIEAAFEQRISLSATG
YFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCSLNPAID
IGQIEGSFIQGMGLYTTEELKYSPEGVLYSRGPDAYKIPTITDVPQEFNVSLLPSSQTPL
TIYSSKGLGESGMFLGSSVFFAITDAVAAARRERDLAEDFIVKSPATPEWVRMACADRFT
EMIPRDDPTTFKPWSIPVA
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatcatctcttttctgttgctaacgcaggtgatcgagaggaatgcggaccca
gaagtcacgctgctgaccttcctacgaaagaaagtacgcctcacaggaaccaagtatgcc
tgcggaagaggaggctgtggtgcctgcaccgtgatggtgtcgaagcgagaccccgtgtcc
cagaagataagacacttctctgtcaccgcatgcctggtgcccatctgctctctgtatgga
gctgctgtcaccactgtggaaggagttggaagcatcaaaaccaggcttcaccccgtgcag
gagagacttgccaagagccacggcacccagtgcggcttctgcacccccgggatggtgatg
tccatgtacgcgctgctcaggaaccacccgcagccctcagaggagcagctcctggcagcc
ctggggggtaacctctgccgctgcactgggtatcggccaattctcgagagtggaaagacc
ttttgctcggagtcaaatggctgtcaacagaaaggaacaggaaaatgctgcctggatcag
ggagaaaatgattctgcctcgctcgacagaaaaagtgacatttgcacagagttatttgcg
aatgaggagttccagcccttggaccccacccaggagctcatatttcccccagaactcttg
agaatggcagagaacccagaaaaacgaactctgacctttcgtggagagagggtcacctgg
atctcccctgggaccctcaaggacctcctggagctgaaagtgaaatatcgggacgctcct
ctcatcatgggcaacacctcactcggacctgcaatgaaatcccaaggacgttttcaccca
attctactctctcctgctaggatttctgagctgagtgtggtgtctaaaacaagtgatgga
ctgacaataggtgctggctgcagcctgtcccaggtgaatgatatcttggctgagagcata
tctgagctcccggaggagaagacccagacgtaccgagccctcctgaagcacctgaagagt
ctggcgggccagcagatccggaacatggcctccttaggaggacatattataagccggcat
tgctattcggatctgaatcccattctgactgtgggcaacactaccctcaatctgatatca
gaaaaaggcacacggcagattcctctaggcgaacattttcttgctggcttggcaagtgca
gatctgaagccaggggaaattttggagtctgtgtatatccctcactctcggaagtgggaa
tttgtgtcagccttccgacaggctgagtgccagcaaaatgccttggccgatgtgaacgct
ggcatgcgagtcctcttcagagacggcacggacaccgtcgaggacctgagcatcgcctac
ggaggggtcggggctgccaccgtcagtgcacaaaagtcctgccagcagcttctagggagg
cgctgggatgagctgctgctggatgaggcttgcaggctgctgctggacgaagtctccctc
ccaggctgggctccaggcgggagagtagaattccggaggactctggtggtcagtttcttc
ttcaagttctacctggaagttctgcaggaactgaagaagggagtagagcagttccctgtg
cctggcacctgccgttctcctgaaatttcagacggattcctaaatgctctagaagacttc
ccggtcaccataccccagggagtccaaaggtaccagagtgtggattctcaccagcccctc
caagatccagtcggacgccccatcatgcacctctcaggtcttaaacatgccacaggtgaa
gccatattttgtgatgacattcccatggtggataaagaactttgcatggctttggtgacc
agtaccagagcccatgcaaaaatcatatcaattgatctgtctgaggcccttgaactaccg
ggggtggttgatgtgataagagctgaggatattccaggcaccaacggtgctgaaggtgac
aagttgttggctgtagatgaggtactttgcgtgggccagatcatctgtgctgtggttgca
gaaacagatgtacaggcaaagcgtgcaagtgaaaagataaagataacctatgaagagctg
gagcctgtaattgtcaccatcgaggatgccataaaacacaactcatttctgtgccctgaa
aaaaaacttgaacaaggaaacatggaggaggcatttgaaaacgtcgatcaaattgttgaa
ggagaggtccacgtgggcggacaggaacacttttacatggaaacgcagagagtgcttgtt
attccaaagaccgaggacaaagaactggacatttatgtgtcaacacaggatccagcccac
gtgcagaaaacggtgtcctctactttaaacatccccatcaacaggatcacctgtcatgta
aaacgagtaggtggaggttttggcgggaaggtgggaagaccagctgtattcggggctatt
gctgctgtgggcgccatcaaaactggtcaccccatccgtcttgttcttgatcgcgaagat
gatatgttaataactgggggaagacatccattatttggaaaatataaagtgggattcatg
aacagcgggcgaatcaaagctctggacattgagtgcttcattaacggagggtgcatgctg
gatgactcggagcaggtgacagaatttcttatactgaagctggaaaatgcatataaaatc
cgcaacctccgactccggggccgtgcgtgcctgacacatttaccatccaacacggccttt
cgtggatttggcttcccgcaaggaaccctggtgacagaatcctgcatcacagctgtggca
gccaaatgtggccttctgccagaagaggttagggagaaaaacatgtacaaaacagttgat
aaaaccatctacaaacaagcgttcagccctgagaccctaataagatgttggaacgaatgt
caggacacgtcctcctttcccagccgaagaatacaagtggaggaattcaataagaagaac
tactggaagaagagaggcattgctatgatccccatgaagttttcagttggctttgctgca
tcaagctatcatcaggcagctgcactggttcatatctacactgatgggtctgtattggtc
acacatggaggcaacgaactgggacaaggtattcacaccaaaatgctacaggtggccagc
cgtgagttaagaatacccatgtcttatctgcacatctgtgaaacaagtacagccacggtg
cctaatacaattgctacagcagcatccatcggctcagatgtcaacggcagagccgtgcag
aatgcttgtcagattcttctgaaacgccttgagcccgtcattaagaaaaatccagaaggc
acctgggaagactggatcgaagctgcttttgaacaaagaatcagtctttcagccactgga
tacttcaggggctacaaggccttcatggactgggagaagggagagggagacccttttccc
tactatgtctatggagcagcctgttctgaggttgaaattgactgcctgacaggagctcac
aagaaaatcagaacggacatcgtcatggatgcctgttgtagtctaaatccagccattgat
attgggcagattgaaggttcatttattcagggaatgggcctctataccactgaagagctg
aaatattccccagaaggtgtcctgtactctcgaggcccagatgcgtacaaaattccaacc
atcactgacgtccctcaagagtttaatgtctccctgctgccatcatcacaaaccccatta
accatctattcatccaagggcctgggggagtccgggatgttcctggggtcatctgtgttc
ttcgccatcactgatgctgtggctgcagcccgcagagaaagagacctagctgaggacttc
atagtgaagagcccagcgaccccagaatgggttcgaatggcctgtgcagatcgattcacg
gagatgatcccaagagatgaccctacaacatttaaaccctggtctatccctgtagcataa

DBGET integrated database retrieval system