KEGG   Sus scrofa (pig): 100525767Help
Entry
100525767         CDS       T01009                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ssc  Sus scrofa (pig)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100525767 (C1GALT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100525767 (C1GALT1)
Glycosyltransferases [BR:ssc01003]
 Glycan extension
  Type 3 chain
   100525767 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 359 aa AA seqDB search
MASKSWLNFLTFLCGSAVGFVLCSQLLSILLGEQSDIQPNILHNDPHARHSDDNGQNHLE
GQINFGADASQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLNTREGRDQLYWKTIKAFQYVHDHYLEDADWFLKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDGFKTDRCTHSSSIED
LALGRCMEIVNVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKMLKEISQVYKNEDPKVN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaaccttcctctgtggatcagcagtcggattt
gttttatgttctcagctacttagtattttgttgggtgaacagagtgacatccagcctaat
attcttcacaatgatcctcatgctaggcattcagatgataatggacagaatcatctggaa
ggacagataaactttggtgcagatgctagccaacataaagatgagaacacagacatcgct
gaaaacctctatcagaaggttaaaattctttgctgggtaatgacagggcctcaaaatcta
gagaaaaaggccaaacatgtcaaagctacatgggcccagcgttgtaacaaggtgttgttt
atgagttcagaagaaaataaagacttccctgctgtgggattaaacaccagagaaggcaga
gaccaactgtactggaaaacaattaaagcttttcagtatgttcatgatcattatttagaa
gatgccgattggtttttgaaagcagatgatgatacgtatgttatactagataacttgaga
tggcttctttcaaaatacaaccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagcggaggtgcagggtatgtactgagtaaagaagccttg
aagagatttgttgatggatttaaaacagacagatgtacacatagttcctccatcgaagat
ttagctctggggagatgcatggaaattgtaaatgtagaagcgggagattccagagacacc
actggaaaagaaacttttcatccctttgtaccagaacaccacttaatcaaggggtatctg
cctagaaccttttggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggttatttatacagatatcaacctgccttacct
gaaaagatgctaaaggaaataagtcaagtatacaaaaatgaagatccaaaagtaaattga

DBGET integrated database retrieval system