KEGG   Sus scrofa (pig): 100525767Help
Entry
100525767         CDS       T01009                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
ssc  Sus scrofa (pig)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:ssc00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 359 aa AA seqDB search
MASKSWLNFLTFLCGSAVGFVLCSQLLSILLGEQSDIQPNILHNDPHARHSDDNGQNHLE
GQINFGADASQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLNTREGRDQLYWKTIKAFQYVHDHYLEDADWFLKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDGFKTDRCTHSSSIED
LALGRCMEIVNVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKMLKEISQVYKNEDPKVN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaaccttcctctgtggatcagcagtcggattt
gttttatgttctcagctacttagtattttgttgggtgaacagagtgacatccagcctaat
attcttcacaatgatcctcatgctaggcattcagatgataatggacagaatcatctggaa
ggacagataaactttggtgcagatgctagccaacataaagatgagaacacagacatcgct
gaaaacctctatcagaaggttaaaattctttgctgggtaatgacagggcctcaaaatcta
gagaaaaaggccaaacatgtcaaagctacatgggcccagcgttgtaacaaggtgttgttt
atgagttcagaagaaaataaagacttccctgctgtgggattaaacaccagagaaggcaga
gaccaactgtactggaaaacaattaaagcttttcagtatgttcatgatcattatttagaa
gatgccgattggtttttgaaagcagatgatgatacgtatgttatactagataacttgaga
tggcttctttcaaaatacaaccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagcggaggtgcagggtatgtactgagtaaagaagccttg
aagagatttgttgatggatttaaaacagacagatgtacacatagttcctccatcgaagat
ttagctctggggagatgcatggaaattgtaaatgtagaagcgggagattccagagacacc
actggaaaagaaacttttcatccctttgtaccagaacaccacttaatcaaggggtatctg
cctagaaccttttggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggttatttatacagatatcaacctgccttacct
gaaaagatgctaaaggaaataagtcaagtatacaaaaatgaagatccaaaagtaaattga

DBGET integrated database retrieval system