KEGG   Sus scrofa (pig): 100525803Help
Entry
100525803         CDS       T01009                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ssc  Sus scrofa (pig)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100525803 (POMT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100525803 (POMT1)
Glycosyltransferases [BR:ssc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100525803 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 725 aa AA seqDB search
MLGFLQRPVVVTADINLNVVALTVVGLLSRLWRLAYPRAVVFDEVYYGQYLSFYMKRIFF
LDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIIRELGFSHCAATGAALLMLIENALITQSRLMLLESLLIFFNLLAVLSYLKFCNSQKHR
PFSASWCFWLVLTGVACSCAVGIKYMGAFTYLLVLGVAAVHAWLLIGDRTLSNVRVLCHL
LARAVALLAVPVLVYLLFFYVHLVLLCRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
YGSQVTLKNVFGKPVPCWLHSHQNTYPVIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVSSPPRPVRHGDVVQLVHGMTTRFLNTHDVAAPLSPHSQEVSCYVDYNISMPAQN
LWRLDIVNRESDAGVWKTILSQVRFVHVNTSAVLKLSGAHLPDWGFRQLEVVGEKLARGY
HESAVWNVEEHRYGKSQEQKERELELHSPTQMDVSRNLSFMARFSELQWRMLTVRSDDSE
HKYSSTPLDWVTLETNIAYWLHPRTSAQIHLLGNVVIWASASLATLAYVLLFLWYLLRRR
RHICDLPEDSWLRWVLAGALCAGGWAVNYLPFFMVEKTLFLYHYLPALAFQILLLPVVLE
HVSHHLCRSQLQRSLFHALVVAWFASACHVSNMLRPLTYGDRSLSPSELRALRWKDSWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttttgcagcgccctgtcgtggtgacggctgacatcaacttgaatgtcgtg
gctctgaccgtggtggggttactgagccgactgtggagacttgcctacccaagggctgtg
gtttttgacgaagtgtattacgggcagtacctctccttttacatgaagcggatcttcttt
ctggacggcagtggtccgcccttcggccacatgctgctggccttaggaggttatttagga
ggcttcgatggcaactttttgtggaacagaattggagcagaatacagcagcaatgtgccc
gtgtggtctctgcgcctgctgccggccctcgcgggggccctgtcggtgcccatggcctac
cagatcatcagggagctcggcttctcgcactgcgccgccacaggggctgctctgctcatg
ctgatcgagaacgccctcatcactcagtccaggctaatgcttttggaatctctgttgata
ttttttaatctgttggccgtgctgtcttacctgaagttctgcaactcccagaaacacagg
cccttctctgcgagctggtgcttttggctggtgctgacgggtgtggcctgctcctgcgca
gttggcatcaaatacatgggtgcgttcacgtacttgcttgtgcttggagttgccgccgtc
cacgcctggcttctgatcggagaccggacactctccaacgtccgcgtgctctgccacctg
ctcgcccgcgcggtggccctgctggccgtccccgtcctcgtgtacttgctgttcttctac
gtccacctggtgctgctctgccgctcggggccccacgaccaaatcatgtccagtgctttc
caggccagcttggagggggggctggcgcggatcacgcaaggccagcccctggaggtggcc
tacggttcccaggtcactctgaagaacgtctttggcaaacccgtgccctgctggcttcac
tcccaccagaacacctaccccgtgatatatgagaacggccgtggcagctcccaccagcag
caggtgacctgttaccccttcaaggacgtcaataactggtggatcgtgaaggatcccggg
aggcaccagctggtggtgagcagccctccgaggcccgtgcggcacggcgacgtggtacag
ctcgtacacggcatgaccacccgcttcctcaacacgcacgatgtggcggcccccctgagc
ccccactcacaggaggtctcctgctacgtggactacaacatctccatgcctgcccagaac
ctctggaggctggacattgtgaacagggagtcggacgcgggcgtgtggaagaccatcctg
tcccaggtccgcttcgtgcacgtcaacacctcggccgtcctgaagctgagcggcgcgcac
ctcccggactggggcttccggcagctggaggtggtcggggagaagctggcccgcggctac
cacgagagcgccgtgtggaacgtggaggagcaccgctacggcaagagccaggagcagaag
gagagggagctggagctgcactcacccacgcagatggacgtcagcaggaacctgagcttc
atggccaggttctcggagctgcagtggcggatgctgacagtgagaagcgatgactcggag
cacaagtacagctccacgccgctggactgggtcacgctggagaccaacatcgcctactgg
ctgcacccccggaccagtgcgcagatccacctgctgggcaacgtggtgatctgggcctcg
gccagcctcgccaccctggcctacgtcctgctcttcctttggtacctgctcagacgccgg
cggcacatctgcgacctccccgaggactcctggctgcgctgggtgctggctggggctctg
tgtgccgggggctgggccgtgaactacctgcccttcttcatggtggagaagacgctcttc
ctctaccactacctgcccgccctcgccttccagatcctgctgctccctgtggtcctggag
cacgtcagccaccacctctgcaggtcccagctccagaggagcctcttccacgcgctggtg
gtggcctggttcgcctctgcctgtcacgtgtccaacatgctgcgcccactaacctacggg
gacaggtcgctctcccccagcgagctcagggcccttcgctggaaagacagctgggacatc
ttgatccgaaaacactag

DBGET integrated database retrieval system