KEGG   Sus scrofa (pig): 100525803Help
Entry
100525803         CDS       T01009                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ssc  Sus scrofa (pig)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ssc00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 725 aa AA seqDB search
MLGFLQRPVVVTADINLNVVALTVVGLLSRLWRLAYPRAVVFDEVYYGQYLSFYMKRIFF
LDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIIRELGFSHCAATGAALLMLIENALITQSRLMLLESLLIFFNLLAVLSYLKFCNSQKHR
PFSASWCFWLVLTGVACSCAVGIKYMGAFTYLLVLGVAAVHAWLLIGDRTLSNVRVLCHL
LARAVALLAVPVLVYLLFFYVHLVLLCRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
YGSQVTLKNVFGKPVPCWLHSHQNTYPVIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVSSPPRPVRHGDVVQLVHGMTTRFLNTHDVAAPLSPHSQEVSCYVDYNISMPAQN
LWRLDIVNRESDAGVWKTILSQVRFVHVNTSAVLKLSGAHLPDWGFRQLEVVGEKLARGY
HESAVWNVEEHRYGKSQEQKERELELHSPTQMDVSRNLSFMARFSELQWRMLTVRSDDSE
HKYSSTPLDWVTLETNIAYWLHPRTSAQIHLLGNVVIWASASLATLAYVLLFLWYLLRRR
RHICDLPEDSWLRWVLAGALCAGGWAVNYLPFFMVEKTLFLYHYLPALAFQILLLPVVLE
HVSHHLCRSQLQRSLFHALVVAWFASACHVSNMLRPLTYGDRSLSPSELRALRWKDSWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttttgcagcgccctgtcgtggtgacggctgacatcaacttgaatgtcgtg
gctctgaccgtggtggggttactgagccgactgtggagacttgcctacccaagggctgtg
gtttttgacgaagtgtattacgggcagtacctctccttttacatgaagcggatcttcttt
ctggacggcagtggtccgcccttcggccacatgctgctggccttaggaggttatttagga
ggcttcgatggcaactttttgtggaacagaattggagcagaatacagcagcaatgtgccc
gtgtggtctctgcgcctgctgccggccctcgcgggggccctgtcggtgcccatggcctac
cagatcatcagggagctcggcttctcgcactgcgccgccacaggggctgctctgctcatg
ctgatcgagaacgccctcatcactcagtccaggctaatgcttttggaatctctgttgata
ttttttaatctgttggccgtgctgtcttacctgaagttctgcaactcccagaaacacagg
cccttctctgcgagctggtgcttttggctggtgctgacgggtgtggcctgctcctgcgca
gttggcatcaaatacatgggtgcgttcacgtacttgcttgtgcttggagttgccgccgtc
cacgcctggcttctgatcggagaccggacactctccaacgtccgcgtgctctgccacctg
ctcgcccgcgcggtggccctgctggccgtccccgtcctcgtgtacttgctgttcttctac
gtccacctggtgctgctctgccgctcggggccccacgaccaaatcatgtccagtgctttc
caggccagcttggagggggggctggcgcggatcacgcaaggccagcccctggaggtggcc
tacggttcccaggtcactctgaagaacgtctttggcaaacccgtgccctgctggcttcac
tcccaccagaacacctaccccgtgatatatgagaacggccgtggcagctcccaccagcag
caggtgacctgttaccccttcaaggacgtcaataactggtggatcgtgaaggatcccggg
aggcaccagctggtggtgagcagccctccgaggcccgtgcggcacggcgacgtggtacag
ctcgtacacggcatgaccacccgcttcctcaacacgcacgatgtggcggcccccctgagc
ccccactcacaggaggtctcctgctacgtggactacaacatctccatgcctgcccagaac
ctctggaggctggacattgtgaacagggagtcggacgcgggcgtgtggaagaccatcctg
tcccaggtccgcttcgtgcacgtcaacacctcggccgtcctgaagctgagcggcgcgcac
ctcccggactggggcttccggcagctggaggtggtcggggagaagctggcccgcggctac
cacgagagcgccgtgtggaacgtggaggagcaccgctacggcaagagccaggagcagaag
gagagggagctggagctgcactcacccacgcagatggacgtcagcaggaacctgagcttc
atggccaggttctcggagctgcagtggcggatgctgacagtgagaagcgatgactcggag
cacaagtacagctccacgccgctggactgggtcacgctggagaccaacatcgcctactgg
ctgcacccccggaccagtgcgcagatccacctgctgggcaacgtggtgatctgggcctcg
gccagcctcgccaccctggcctacgtcctgctcttcctttggtacctgctcagacgccgg
cggcacatctgcgacctccccgaggactcctggctgcgctgggtgctggctggggctctg
tgtgccgggggctgggccgtgaactacctgcccttcttcatggtggagaagacgctcttc
ctctaccactacctgcccgccctcgccttccagatcctgctgctccctgtggtcctggag
cacgtcagccaccacctctgcaggtcccagctccagaggagcctcttccacgcgctggtg
gtggcctggttcgcctctgcctgtcacgtgtccaacatgctgcgcccactaacctacggg
gacaggtcgctctcccccagcgagctcagggcccttcgctggaaagacagctgggacatc
ttgatccgaaaacactag

DBGET integrated database retrieval system