KEGG   Sus scrofa (pig): 100525912Help
Entry
100525912         CDS       T01009                                 

Gene name
DHFR
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ssc  Sus scrofa (pig)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100525912 (DHFR)
   00670 One carbon pool by folate
    100525912 (DHFR)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100525912 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 187 aa AA seqDB search
MVRPLNCIVAVSQNLGIGKNGDLPWPPLRNEYKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLTEQPELKNKVDMVWIVGGSS
VYKEAMNKPGHIRLFVTRIMKEFESDAFFPEIDLEKYKLLSECSGVPSDVQEEKGIKYKF
EVYEKNN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtccgctaaactgcatcgttgctgtgtcccagaacttgggcattggcaagaac
ggggacctgccctggcccccgctcaggaacgaatacaaatatttccaaagaatgaccaca
acctcttcagtagaaggcaaacagaatttggtgattatgggtaggaagacctggttctcc
attccggagaagaatcgacctttaaaggacagaattaatatagttctcagtagagaactc
aaggaacctccacagggagctcattttcttgccaaaagtctggatgatgccttaaaactt
actgagcagccagaattaaaaaataaagtggacatggtttggatagtgggaggcagttca
gtttataaggaagccatgaacaagccaggccatattagactttttgtgacaaggatcatg
aaagaatttgaaagtgacgcatttttcccagaaattgacttggaaaaatataaacttctc
tcagaatgttcaggagttccttctgatgtccaggaagagaaaggcattaagtacaaattt
gaagtatatgaaaagaacaattaa

DBGET integrated database retrieval system