KEGG   Sus scrofa (pig): 100620270Help
Entry
100620270         CDS       T01009                                 

Definition
serine/threonine-protein kinase NLK-like
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100620270
   04310 Wnt signaling pathway
    100620270
   04068 FoxO signaling pathway
    100620270
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    100620270
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100620270
Protein kinases [BR:ssc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100620270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 359 aa AA seqDB search
MPNVFQNLVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHK
IIVSPQPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARV
EELDESRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQ
QLDLITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRML
VFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFE
KNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgtcttccagaatctggtctcttgcaaaagggtcttccgggaattgaagatg
ttgtgtttttttaaacatgataatgtactctctgcccttgacatactccaacctccacac
attgactattttgaagagatatatgttgtcacagaattgatgcagagtgacctacataaa
attatcgtctctcctcaaccactcagctcagatcatgtcaaagtttttctttatcagatt
ttgcgaggtttgaaatatctccattcagctggcattttacatcgagacattaagccaggg
aatctccttgtgaacagcaactgtgttctaaagatttgtgattttggattggccagagtg
gaagaattagatgaatcccgtcatatgactcaggaagttgttactcagtattatcgggct
ccggaaatcctgatgggcagccgtcattacagcaatgctattgacatctggtctgtcggg
tgtatctttgcagaactactaggacgaagaatactgtttcaggcacagagtcccattcag
cagttggatttgatcacagatctcttgggcacaccatcgctggaagcaatgaggacggct
tgtgaaggcgctaaggcacacatactcaggggtcctcataaacagccatctcttcctgta
ctttataccctgtccagccaggctacacatgaagctgttcatctcctttgcaggatgttg
gtctttgatccatccaaaagaatatccgctaaggatgccttagcccacccctacctagat
gaagggcgactacgctatcacacgtgcatgtgtaaatgttgcttttccacttcgacggga
agagtttataccagtgactttgagcccgtcaccaatcccaaatttgatgacacttttgag
aagaacctcagttctgttcgacaggttaaagaaatcattcaccagttcattttggaacag
cagaaaggaaacagagtgcctctctgcatcaaccctcagtctgctgcttttaagagcttt
attagttccactgttgctcagccgtctgagatgcctccatctcctctggtgtgggagtga

DBGET integrated database retrieval system