KEGG   Sus scrofa (pig): 100620614Help
Entry
100620614         CDS       T01009                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type isoform X2
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00590  Arachidonic acid metabolism
ssc01100  Metabolic pathways
ssc01523  Antifolate resistance
ssc04726  Serotonergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100620614 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100620614 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100620614 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    100620614 (ALOX12)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100620614 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 100620614
NCBI-ProteinID: XP_003483140
Ensembl: ENSSSCG00000017930
Vega: OTTSUSG00000002442
UniProt: F1RF49
Position
12
AA seq 663 aa AA seqDB search
MGRYRIRVATGDSIFAGSLNSVQLGLVGARGETELELQLRPARGQEEEFGLDAPKDLGPL
QFVKLRKHHSLVDDAWFCDRITVQGPGAGEEVAFPCYRWVQGDGVLCLPEGTARLAGDNA
LDVFQKHREKELKERRQIYCWATWKEGLPQTIAAGCEDDLPPNVRFHEEKRRDFEWTLKA
GALEMVLKRVYTLLSSWNHLEDFDNIFWGQKSTLAEQVRQHWQEDELFGYQFLNGANPML
LRRCTSLPSRLVLSSGMEALRAQLEKELENGSLFKADFTLLDGIPANVIRGEQQYLAAPL
VLLKMEPSGKLLPMVIQIQPPSHSCPTPPLFLPSDPPLAWLLAKCWVRNSDFQLHQLQYH
LLNTHLLAEVIAVATMRCLPGLHPVFKLLIPHIRYTMEINTRARTQLISDGGIFDKAVGT
GGGGHVHLLRRAMAQLTYRSLCPPHDLADRGLLGTPGAHYAHDALQLWEITARYVEGIVQ
LFYHGDDVVKEDPELQAWCREITEVGLCQAQDRGFPVSLQSQNQLCHFLTMCVFTCTAQH
GAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAITWHLGRR
QPDMVPLGHHKEMYFSSPKAKAVLNQFQRDLENLEKAITARNEQLNLPYEYLRPSLIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcatccgggtggccaccggagactcgatcttcgccgggtcgctcaac
agcgtgcagctggggctggtcggggcgcgcggggagacggagctggagctgcagctgcgg
ccggcgcggggccaggaggaggagttcgggcttgacgctcccaaggacttggggccgctg
cagttcgtcaagctgcgcaaacaccactccctggtggacgacgcgtggttctgcgaccgc
atcacggtgcagggccctggagccggcgaggaggtcgccttcccctgctaccgctgggtg
cagggggacggcgtactgtgcctgcccgagggcaccgcccgcctggcaggagacaatgca
ctggacgtgttccagaagcatcgagaaaaggaactgaaagaaagacgtcagatatactgc
tgggccacctggaaggaagggttaccccagacaatagctgcaggctgtgaggatgaccta
cctccaaacgtgagattccatgaggagaagaggagagactttgagtggacactgaaggca
ggggctctggagatggtcctcaagcgtgtctacaccctcctgagctcctggaaccacctg
gaggattttgataacatcttctggggccagaagagcaccctggctgagcaggttcgccag
cactggcaggaggatgaactctttggctaccagttcctcaatggcgccaaccctatgctg
ttgagacgctgcacctctctgccctcccggctcgtgctgtcctcggggatggaggcgcta
cgggcccagctggaaaaagaactcgagaatggctccctgttcaaggccgatttcaccctc
ctggatggaattccggccaacgtgatccgcggagagcagcagtacctggctgcccccctc
gtcctgctgaagatggagcccagcgggaagctgctacccatggttatccagatccagcct
cccagccacagctgtcccacgccacccctgttcctgccctccgatcctccccttgcctgg
ctcctggccaagtgctgggtccgaaattccgatttccagctgcaccagctccagtatcat
ctgctgaacacccacctgctggctgaggtcattgccgtggccaccatgaggtgtctccca
gggctgcaccctgtcttcaagctcctgatcccacacatccgctacactatggaaatcaac
acgcgggcccggacccagctcatctcggacggaggtatattcgataaggcagtgggcacc
ggtggagggggccacgtgcacttgctccgccgggcgatggctcagctgacctaccgctcc
ctctgtccccctcacgatctggctgaccgcggcctgctgggaaccccaggggctcactat
gcccacgatgctttgcagctctgggagatcactgctcggtacgtggaggggattgtccag
ctcttctaccacggggacgatgtcgtcaaagaggaccctgagctgcaggcctggtgtcgg
gagatcactgaggtggggctgtgccaggcccaggaccgaggtttccctgtgtccctccag
tcccagaaccaactctgccatttccttaccatgtgcgtcttcacgtgcaccgctcagcac
ggggccatcaaccagggccagctggactggtacgcctgggtccctaatgccccctgcacg
atgcggatgcccccacccaccaccaaggaagacgtgacaatggccacagtgatgggctcg
ctacctgatgtccgacaggcctgtcttcaaatggccatcacatggcatctgggtcgccgc
cagccagacatggtgcctctggggcatcacaaagaaatgtatttctcaagccccaaggcc
aaggctgtactaaaccaattccaaagagatttggaaaacttggaaaaggctattacagcc
cgcaatgagcaacttaacctgccctatgaatacctgaggcccagcctcatagagaacagc
gttaccatctga

DBGET integrated database retrieval system