KEGG   Sus scrofa (pig): 100621099Help
Entry
100621099         CDS       T01009                                 

Gene name
ACHE
Definition
acetylcholinesterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100621099 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100621099 (ACHE)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100621099 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 613 aa AA seqDB search
MRPPWCPLHTPSLASPLLLLLFLLGGGAEAEGPEDPELLVTVRGGRLRGISLMAPGGPVS
AFLGIPFAEPPVGPRRFLPPEPKRPWPGVLDATAFQSVCYQYVDTLYPGFEGTEMWNPNR
ELSEDCLYLNVWTPYPRPASPTPVLVWIYGGGFYSGASSLDVYDGRFLAQVEGTVLVSMN
YRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPMSVTLFGESAGAASVG
MHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRTRTAQDLVDHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHSLQVLVGV
VKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPED
PARLREAMSDLVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYE
IEFIFGLPLEPSLNYTVEERTFAQRLMRYWANFARTGDPNDPWDSKAPQWPPYTAGAQQY
VSLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaggccaccgtggtgtcccctgcacacgccctccctggcttccccactccttctcctc
ctcttccttctgggaggaggggcagaggctgagggcccagaggacccggagctgctggtg
acggtgcgtgggggccggcttcgaggcattagcctaatggcccctgggggccctgtctct
gcttttctgggcatccccttcgcagagccacctgtgggcccccgtcgctttctgccaccg
gagcccaagcggccctggccaggggtgctggatgccacagccttccaaagcgtctgctac
caatatgtggacaccttgtaccctggctttgagggcactgagatgtggaaccccaaccgt
gagctgagtgaggactgcctctacctcaacgtgtggacaccgtaccccaggcctgcgtcc
cccacccctgtccttgtctggatctacgggggtggcttctacagcggggcctcctccctg
gacgtgtatgatggccgcttcctggcccaggtggaggggactgtgctggtgtccatgaac
tacagggtgggagcctttggcttcttggccctgcccgggagccgggaggcccctggcaat
gtgggtctgctggatcagaggctggcactgcagtgggtgcaggagaatgtggcagccttt
ggaggggacccaatgtcagtgactctgtttggggaaagcgcaggtgcagcctctgtagga
atgcacctgctgtccccacccagccggggcctgttccacagggcggtgctgcagagcggt
gcacccaatgggccctgggccacggtgggtgtgggagaggcccgccgcagggccacactg
ctggcccgcctcgtgggctgtcccccaggtggagctggtggcaatgacacagaactggtg
gcctgcctgcggacgcggacagctcaggatctcgtggaccacgagtggcatgtgctgcct
caggaaagcgtcttccgcttctccttcgtgcctgtggtggacggagactttctcagtgac
acgcctgaggccctcatcaatgctggagacttccacagcctacaggtgctggtgggtgtg
gtgaaggatgagggctcctattttctggtttacggggccccaggcttcagcaaagacaac
gagtctctcatcagccgggcccagttcctggccggggtgcgggtcggggtcccccaggca
agcgacctggctgccgaggctgtggtcctgcattacacagactggctacaccctgaggac
ccagcacgcctgagggaggccatgagtgatttggtgggcgaccacaacgtcgtgtgcccc
gtggcccagctggctgggcgactggccgcccagggcgccagagtctatgcctacgtcttt
gaacaccgagcatccacactctcctggcccctctggatgggggtgccccacggctacgag
atcgagttcatcttcgggctccccttggaaccctcgctaaactacaccgtcgaggagaga
acctttgcccagcgactgatgagatactgggccaacttcgcccgcacaggggaccccaat
gacccctgggattccaaagccccgcagtggcccccgtacacggcgggagcgcagcagtac
gtgagcctgaacctgcggccgctggaggtgcgacgcgggctgcgtgcccaggcctgcgcc
ttctggaaccgcttcctacccaaattgctcagcgccacagacacgctggacgaggcggag
cgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaaccag
tttgaccattacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system