KEGG   Sus scrofa (pig): 100621371Help
Entry
100621371         CDS       T01009                                 

Definition
calcineurin B homologous protein 1-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
ssc  Sus scrofa (pig)
Brite
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100621371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDMNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacccgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccagcggattccagaacttgccatcaac
ccattaggggaccggatcatcaatgctttctttccagaaggagaggaccaggtaaacttc
cgtggcttcatgagaactttggctcatttccgacccattgaggataatgaaaagagcaaa
gatatgaatggaccagaaccactcaatagccgaagcaacaaactgcactttgcttttcga
ctgtatgacttggataaagatgacaagatctcccgtgacgagctgttacaggtgctacgc
atgatggttggggtgaatatctcagatgagcagctgggcagcatcgcagacaggaccatc
caggaggctgaccaggatggggacagcgccatctctttcacggaatttgttaaggtttta
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactga

DBGET integrated database retrieval system