KEGG   Sus scrofa (pig): 100621417Help
Entry
100621417         CDS       T01009                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssc  Sus scrofa (pig)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100621417 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100621417 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100621417 (GPX7)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100621417 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 186 aa AA seqDB search
MVAALVAAWLLLAAAARAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEIRPQITALVRKLIL
KKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgcactcgtggcggcgtggctgctcctggcggcggcggcccgcgcgcagcgg
gagcaggacttctacgacttcaaggcggtcaacatccggggcaagttggtgtcgctggag
aagtaccgcggctcggtgtcccttgtggtgaatgtggctagcgagtgtggcttcacagac
cagcactaccgcgccctgcagcagctgcagagggacctggggccccaccacttcaacgtg
ctcgccttcccctgcaaccagtttggtcagcaggagcccgacagcaacaaggagatcgag
agcttcgcccgtcgcacctacagtgtctctttccccatgttcagcaagatcgcagtcaca
ggcacaggggcccaccctgccttcaagtacctgacccagacttccgggaaggagcccacc
tggaacttctggaagtacctcgtggccccagatggaaaggtagtaggggcttgggaccca
accgtgtcggtggaggagatcaggcctcagattacggcgctcgtgaggaagctcatcctg
aagaagcgagaagacttgtaa

DBGET integrated database retrieval system