KEGG   Sus scrofa (pig): 100621417Help
Entry
100621417         CDS       T01009                                 

Definition
glutathione peroxidase 7-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ssc  Sus scrofa (pig)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ssc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ssc00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:ssc04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 242 aa AA seqDB search
MKSPPSSLCKVDLGLWFGKGEELVSNGQGALHPDLDGPHTKMTVSVLPPGARPSLVKKVL
SLELLNYAGSMGDSSSCPDCPPRLPLGGGPLYGASQYNPASSKKVASEIRLGCPDTGFTD
QHYRALQQLQRDLGXVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGA
HPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEIRPQITALVRKLILKKRE
DL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccctccaagttcactttgcaaggtggacctggggctgtggtttggaaagggt
gaggagttggtctccaatggacagggagccctgcatccagatttggatggaccacacaca
aaaatgactgttagcgttcttcccccaggagcgaggccatctttagtgaagaaagtacta
agccttgaacttctcaactatgctgggagtatgggagacagcagttcatgtcctgattgt
cccccaaggctgccccttggaggtggccctctttatggagccagccagtataatcccgcc
tcttctaaaaaagtggccagcgagatacggctgggctgcccagacacaggcttcacagac
cagcactaccgcgccctgcagcagctgcagagggacctggggcncgtgctcgccttcccc
tgcaaccagtttggtcagcaggagcccgacagcaacaaggagatcgagagcttcgcccgt
cgcacctacagtgtctctttccccatgttcagcaagatcgcagtcacaggcacaggggcc
caccctgccttcaagtacctgacccagacttccgggaaggagcccacctggaacttctgg
aagtacctcgtggccccagatggaaaggtagtaggggcttgggacccaaccgtgtcggtg
gaggagatcaggcctcagattacggcgctcgtgaggaagctcatcctgaagaagcgagaa
gacttgtaa

DBGET integrated database retrieval system