KEGG   Sus scrofa (pig): 100621486Help
Entry
100621486         CDS       T01009                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ssc  Sus scrofa (pig)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100621486
Enzymes [BR:ssc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100621486
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100621486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 132 aa AA seqDB search
HTTLSFLGHQDERGSAADSEDSPAIEAIRLLRKNFPSLLVACDVCLCPYTSHGHCGLLSE
NGSFQAEESRQRLAEVALAYAKAGCQVIAPSDMMDGRVEAIKEALMAHGFGNRVSVMSYS
AKFASCFYGPFR
NT seq 400 nt NT seq  +upstreamnt  +downstreamnt
acacaccactttgtccttcctcggccaccaggatgagcggggctctgcagccgactctga
ggactccccagctatcgaggcgatccgtctgctgcgcaagaacttcccgagcctcctggt
ggcctgcgatgtctgcctgtgcccctacacctcccacggtcactgcgggcttctgagtga
gaatgggtccttccaagctgaggagagccgccagcggctggcggaggtggcactggccta
tgccaaggcaggatgtcaggtgatagccccgtcggacatgatggatggacgcgtggaagc
cattaaggaggctctgatggcacatggattcggcaaccgggtatcagtgatgagctatag
cgccaaattcgcttcctgtttctacggacctttccggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system