KEGG   Sus scrofa (pig): 100621523Help
Entry
100621523         CDS       T01009                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
ssc  Sus scrofa (pig)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:ssc04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:ssc04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:ssc05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH
GGTLNKKAYELALYLRRSDV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaagcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacagctgggggcgtcttc
cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaatggtttgactcttggcgcaaagaaatgctcagtgatcagagatagcctatacgtg
gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac
ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg
taa

DBGET integrated database retrieval system