KEGG   Sus scrofa (pig): 100621636Help
Entry
100621636         CDS       T01009                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100621636 (ABHD12)
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100621636 (ABHD12)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100621636 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
17
AA seq 396 aa AA seqDB search
MRKRAEPVALEHERRAVSGSPSAGSAASALDADCRLKQNLCLAGPGPAEPRCASDAGMKR
ALGRRKGLCFRLRKILLCVLGLYVAIPFLIKLCPAIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLHPEEGVTIGVWHTVPAVWWKNAQGKDQIWYEDALASSRPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIQFANDENVKHISCSLLILHAEDDPVVPFQLGRKLYSIAAPSRSFRDFKVQ
FIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagagggccgagcctgtcgctctggagcatgagcgccgcgccgtctcgggctcg
ccctccgccggctcggccgcctcggcgctggacgccgactgccgcctgaagcagaacctg
tgcctagcgggccccgggccggctgagccgcgctgcgcctccgacgcgggcatgaagcga
gcgctgggcagacgaaagggcctgtgcttccggctaaggaagatactcctctgtgtcctg
gggttgtatgtggccattccatttcttatcaaactatgtcctgcgatacaggccaaactg
attttcttgaattttgtgcgggttccctatttcattgatttgaaaaaaccacaggatcaa
ggtttgaatcacacctgtaattactacctccatccagaggaaggcgtgaccattggagtc
tggcacaccgtaccagctgtctggtggaagaatgcccaagggaaggaccagatctggtat
gaggatgccttggcttccagccgccctattatcctgtacctgcacgggaacgcgggcacc
agaggaggcgaccaccgggtggagctctacaaggtgctgagttcccttggctaccatgtg
gtcacctttgactacagaggttggggtgactccgtgggaacgccatcggagcggggcatg
acgtatgatgcactccatgtctttgactggatcaaagcgcgaagtggcgacaaccctgta
tatatttggggccattcccttggcactggagtggccaccaacctggtgcggcgcctgtgt
gagcgagagacacctccagatgccctcatattggagtctccattcacgaacatccgtgaa
gaagctaagagccatccattctcagtgatctatcgctactttcctgggtttgactggttc
ttcctcgatcccatcaccagcagtggaattcagtttgcaaatgatgaaaatgtgaagcac
atctcctgctctctgcttatcctacatgccgaggacgacccggtcgtgcccttccagctt
ggcagaaagctctacagtattgctgcgccatcccgaagcttccgagacttcaaggttcag
ttcatccccttccactcggacctcggctacaggcacaagtacatctacaagagtcccgag
ctcccacggatcctgagggaattcctggggaagtcggaacccgctgcctga

DBGET integrated database retrieval system