KEGG   Sus scrofa (pig): 100621757Help
Entry
100621757         CDS       T01009                                 

Gene name
PFKL
Definition
phosphofructokinase, liver
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100621757 (PFKL)
   01230 Biosynthesis of amino acids
    100621757 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100621757 (PFKL)
   00030 Pentose phosphate pathway
    100621757 (PFKL)
   00051 Fructose and mannose metabolism
    100621757 (PFKL)
   00052 Galactose metabolism
    100621757 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100621757 (PFKL)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100621757 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100621757 (PFKL)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100621757 (PFKL)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100621757 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 759 aa AA seqDB search
MATVDLEKLRTSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLICEGYEGLVE
GGENIKPANWLSVSNIIQLGGTVIGSARCKAFTTREGRLAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLAELVSEGRISESTAQTYSHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPITSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
AMDEKRFDEAIQLRGRSFENNWNIYKLLAHQKISKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKAYLEKI
VENIRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMEVGTGPAAPRGLPSRGVRLWGPPRLAVCVGRGQELANVEHMTEKMKTDIQR
GLVLRNEKCHEYYTTEFLYNLYSSEGRGIFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVK
AILWMSEKLRAVYRKGRVFANAPDSACVIGLQKKAVAFSPVTELKEDTDFEHRMPREQWW
LNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIETGF
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgtggacctggagaagctgcgcacgtcgggggccggcaaggccatcggcgtg
ctgaccagcggcggcgatgcgcaaggcatgaatgccgccgtcagagccgtcacgcgcatg
ggcatctacgtgggggccaaggtcttcctcatctgcgagggctatgagggcctcgtggaa
ggaggcgagaacatcaagccggccaactggctcagcgtctccaacatcatccagctgggc
ggtacggtcatcggcagcgcccgctgcaaggccttcaccacgcgggaggggcgcctggcg
gcggcctacaacctagtccagcgtggcatcaccaacctgtgtgtcattggcggggacggc
agcctcacgggagccaacatcttccgcagcgagtggggcagcctgctggcggagctggtg
agcgaaggcaggatctcagagagcacggcccagacttactcacacctgagcatcgccggg
ctggtgggctccatcgacaacgacttctgcggcaccgacatgaccatcggcaccgactcg
gccctgcaccgcatcatggaggtcatcgacgccatcaccaccaccgcccagagccaccag
aggacttttgttctggaggtgatggggcggcactgcgggtacctggccctggtgtccgcc
ctggcctcgggggccgactggctgttcatccctgaggcgccccccgaggacggctgggag
aacttcatgtgtgagcggcttggcgagacgcggagccgagggtcccgactcaacatcatc
atcatcgcggagggcgccatcgaccgccacgggaagcccatcacctcgcgctacgtcaag
gacctggtggtgcagaggctgggcttcgacacgcgtgtgactgtgctgggccacgtgcag
aggggagggaccccgtcggcgttcgaccgcgtcctgagcagcaagatgggcatggaggcg
gtgatggcgctgctggaggccacgcccgacacgccggcctgcgtggtcagcctctcgggg
aaccagtctgtgcggctgcccctgatggagtgcgtgcagatgaccaaggaggtgcagaag
gccatggacgagaagaggttcgacgaggccatccagctacggggcaggagctttgagaac
aactggaacatttacaagctgcttgcgcaccagaagatctccaaggagaagaccaacttc
tctctggccatcctgaacgtgggcgccccggcggccggcatgaatgcagctgtgcgctcg
gccgtgcgttccggcatctcccagggccacacggtgtacgtcgtgcacgacggctttgag
ggcctggccaagggccaggtgcaagaagtgggctggcatgacgtggccggctggctgggc
cgtggtggctccatgctggggaccaagaggacgctgcccaaggcctacttggagaaaatt
gtggaaaatattcgcacttacaacatccacgccctgctggtcatcggtggcttcgaggcc
tacgaaggggtgctgcagctggtggaggcccgcgggcgctacgaggagctctgcattgtc
atgtgtgtcatccctgccaccatcagcaacaacgtgccaggcaccgacttcagcctgggc
tccgacaccgccgtcaacgctgccatggaggtggggacgggacccgccgcccccagaggg
ctgccgagccggggggtcaggctgtggggtccaccaaggctggctgtctgcgtggggcgt
gggcaggagctggccaacgtggagcacatgacggagaagatgaagaccgacatccagagg
ggcctggtgctccgaaacgagaagtgccacgaatactacaccacggagtttctctacaac
ctgtactcctccgaggggaggggcatctttgactgcaggaccaacgtcctgggccacctg
cagcagggcggagctcccactcccttcgaccggaactacggtaccaagctgggggtgaag
gccatcctctggatgtccgagaagctgcgggcagtctaccgcaaggggcgggtgtttgcc
aacgcccccgactcggcctgcgtgatcggcctgcagaagaaggcggtggccttcagcccg
gtcactgagctcaaggaggacaccgactttgagcaccgcatgccccgggagcagtggtgg
ctgaacctgcggctcatgctgaagatgctggcgcactaccgcatcagcatggccgactac
gtgtccggggagctggagcacgtcacccgccgcaccctgagcatcgaaaccggcttctga

DBGET integrated database retrieval system