KEGG   Sus scrofa (pig): 100621820Help
Entry
100621820         CDS       T01009                                 

Definition
(RefSeq) chymotrypsinogen 2-like
  KO
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100621820
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100621820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 309 aa AA seqDB search
MPRKRIITSRPLDNSLVPGPRKELLVHRGIKGNSPRLQPPPLDCSAMTFLWLLSCCALLG
TAFGCGVPAIPPVLSGLSRIVNGEDAVPGSWPWQVSLQDSTGFHFCGGSLISEDWVVTAA
HCGVTTSDVVVAGEFDQGSDAESIQVINIAKVFKNPRYSWFINSNDITLLKLATPARFSE
TVSAVCLPSASDDFPAGTLCVTTGWGLTKYTDANTPDRLQQAALPLLSNAACRRYWGFRI
TKSMICAGASGVSSCMGDSGGPLVCQKDGVWTLVGIVSWGSSTCSTSSPGVYARVTQLVS
WVHQIVAAN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaaaggattatcacctcaaggcctctagataacagcctggtgcctgggcca
cggaaggagctactggtacacaggggtataaaggggaactctccacgcttgcaacctcca
cctcttgactgcagcgccatgaccttcctctggctcctctcctgctgcgccctcctgggc
acggcctttggctgcggggtccccgccatcccgccggtgctgagcggcctgtctaggatc
gtcaatggggaggacgctgtccccggctcctggccctggcaggtgtccctgcaggacagc
accggcttccacttctgcggggggtccctcatcagtgaggactgggtcgtcaccgccgcc
cactgcggggtcacaacctccgatgtggttgtggctggcgagtttgaccagggctcagac
gccgagagcatccaggtgataaacattgcgaaggttttcaagaaccccaggtacagctgg
ttcataaacagcaacgacatcaccctactgaagctggccacgcccgcgcgcttctccgag
accgtgtccgccgtgtgcctgcccagcgcctccgacgacttcccggccgggacactgtgc
gtcaccaccggctggggcctgaccaagtacaccgacgccaacacccccgacaggctgcag
caggcggccctgcccctgctgtccaacgctgcctgcaggaggtactggggcttcaggatc
accaaaagcatgatctgcgccggcgccagcggcgtctcctcctgcatgggcgactctggc
ggccccctggtctgccagaaggatggagtctggaccctggtgggcatcgtgtcctggggc
agcagcacctgctccacctccagccccggcgtgtacgcccgtgtcactcagctcgtctcc
tgggtgcatcagatcgtggctgccaactga

DBGET integrated database retrieval system