KEGG   Sus scrofa (pig): 100622210Help
Entry
100622210         CDS       T01009                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ssc  Sus scrofa (pig)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ssc00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 901 aa AA seqDB search
MKIAVIGQSLFGQEVYNHLKEEGHKVVGVFTVPDQDGKVDPLGLKAEQDGVPVFKFTRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRYGSIIYHPSLLPRHRGASSIN
WTLIHGDKKAGFTIFWADDGLDTGDLLLQKECDVLPDDTVNTLYSRFLFPEGVKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETARINWEQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTAGLVPEGEAVPIPGAHRPGVVTKAGLLLFGNDDQMLLVKNIQLEDGKMI
PASQLFRGMDNSALELTEEELATAEAVRGAWKRILPSVPEVDDSTDFFKSGAASVDVVRL
VEEVKELCDGMELENEDVYMATTFGDFIQLLVRKLRGDKESECVIDYVEKAVNKLTLHMP
HQLFIGGEFVDAEGARTYETINPTDGSVICQVALAQVSDVDKAVAAAKDAFEHGLWGRIS
ARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCGKIQ
GSTIPINQARPNRNLTLTRREPIGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQV
TPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS
CALSNVKKVSLELGGKSPLIIFSDCDLSRAVQMGMSAVFFNKGEHCIAAGRLFVENSIHD
QFVQKVVEEVGKMKIGNPLDRDTNHGPQNHQAHLRKLVEYCQRGVKEGATLVCGGNQVPR
PGFFFEPTVFTDVEDHMFIAREESFGPIMIISRFADGDMDTVLSRANATEFGLASGVFTR
DINKALYVSDKLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFE
Y
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcagtgattggacagagcctgtttggccaggaagtttacaaccacctgaag
gaggagggtcacaaggtcgtgggcgtgttcactgtgccagaccaggatgggaaggtggac
cccctgggcctgaaggctgagcaggatggagtgccggtgttcaagttcacccgctggagg
gcaaaggggcaggctctgcccgacgtggtggcgaagtaccaggccctgggtgccgagctc
aacgtcctgcccttctgcagccagttcatccccatggagatcatcagtgccccccgctat
ggctccatcatctaccacccgagcctgctcccccggcaccgaggggcctcatccatcaac
tggaccctcattcatggagacaagaaagcggggtttaccatcttctgggcggatgatggc
ctggacactggagaccttctgttgcagaaggagtgtgacgtcctcccggatgataccgtg
aacacgctgtacagccgcttcctcttcccagaaggcgtcaaagggatggttcaggccgtg
aggctgattgccgaaggcaaagcccccagactcccgcagcctgaggaaggagccacctat
gaggggattcagaagaaagaaacagccaggatcaactgggaacagccagcagaggccatt
cataactggatccgcgggaacgacaaggtgccaggtgcctggacagaagcctgtgggcag
aaactgacatttttcaactcaacgctgaataccgcaggcctggtgccagagggagaagct
gtgcccatcccaggagcccatcggccaggggtggtcaccaaagcgggactcctcctcttc
gggaatgacgaccaaatgctgctggtgaagaacatccagctggaggatggcaagatgatc
ccagcctcgcagctcttcaggggaatggacaacagcgccctggagctgacagaggaggag
ctggccactgcggaggctgtgcggggtgcctggaaacggattctgcccagcgtcccagag
gttgatgactccactgatttcttcaagtcgggcgccgcgtcggtggatgttgtgaggctg
gttgaggaggtgaaggagctgtgtgatggcatggaactggagaatgaagatgtttacatg
gccactacctttggagacttcatccagctgttagtgagaaagctgcgaggggacaaggag
agcgagtgtgtcattgactatgtggaaaaggcagtgaacaagctgaccctccacatgccc
caccagctcttcattgggggcgagtttgtggatgctgagggggccaggacctacgaaacc
atcaacccgactgatggaagcgtcatatgccaggtggccctggcccaggtcagcgatgtg
gacaaggcagtggctgccgcaaaggatgcctttgagcacgggctgtggggcaggattagt
gcacgggaccgcggccgcctcctgtacaggttggcagacctcatggaacagcaccaggag
gagctggccaccatcgaggcgctggatgcaggtgctgtctacacactggccctgaagacc
cacgtgggcatgtccatccagaccttccgctacttcgctggctggtgcggcaagatccag
ggcagcaccatccccatcaaccaggccagacccaaccggaacctgaccttgaccaggagg
gagcccatcggggtctgtggcattgtcatcccctggaactaccccctgatgatgctgtcc
tggaagacggccgcctgcctggctgctggaaacacagtggtgatcaagcccgcccaggtg
accccgctcacagccttgaagtttgcagagctgaccctgaaggccggcattcccaagggt
gtggttaacatcctgccaggatctggctcactggtcggccagaggctctcggaccatccc
gatgtgcggaaaattgggttcacgggctccaccgaggtgggaaagcacatcatgaaaagc
tgtgccctgagcaatgtgaagaaggtctccctagagctgggcggaaagtctcccctcatc
atcttctccgactgtgacctcagcagggctgtgcagatggggatgagcgcagtgttcttc
aacaaaggtgagcactgcatcgcagccggccggctctttgtggagaactcgattcatgac
cagtttgtgcagaaggtggtggaagaggtggggaagatgaagatcggcaaccctctcgac
cgggacaccaaccacgggccgcagaaccaccaggcccacctccggaagctggtggagtac
tgccagcgtggcgtgaaggagggggccacgctggtctgcggggggaaccaagtccctcgg
ccaggcttcttctttgagccgaccgtcttcacggacgtggaggaccacatgttcatagcc
cgggaggagtccttcgggcccatcatgatcatctcccgatttgctgacggcgacatggac
accgtgctgtctcgggccaacgccacagagtttggcctggcctctggtgtcttcaccagg
gacatcaataaggccctgtacgtcagcgacaagctggaggcgggcacagtgttcatcaac
acctacaacaagaccgacgtggccgccccctttggagggttcaagcagtccggatttggc
aaagacctgggagaggcagccctgaatgagtacctgcgggtcaagacggtcaccttcgag
tactga

DBGET integrated database retrieval system