KEGG   Sus scrofa (pig): 100622645Help
Entry
100622645         CDS       T01009                                 

Definition
GTP cyclohydrolase 1-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssc  Sus scrofa (pig)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssc00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 367 aa AA seqDB search
MTHPEQEKMDLLTQAEDAVLFLCLLPMPHITEGDFSVFPLQREKKGKGLHSLCFSLHLGH
LVRHFRIALTPQASFWNLEVEQEAFIGSTLLLSYVHLDPEYPPNFCRVKVLATINTILLD
TGTHPADGWKGERPRSEEDNELNLPNLAAAYTSILRSLGEDPQRQGLLKTPWGAATAMQF
FTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFIGKVHIGYLPNKQVLG
LSKLASTLENLHPVSTLACEVKLYEGTKNSRFARVKLHHPWVLPEKVPPDYSPNCRRRKM
RQSIMQKRQTTYCLLLETIFVALFCRHMCMVMRGVQKMNSRTVTSTMLGVFREDPKTREE
FLTLIKS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacacatccggagcaagagaaaatggaccttttaactcaagcagaggatgctgtgctg
tttctctgcctcctgcccatgcctcatatcaccgagggtgacttctctgtgtttccttta
cagcgagagaagaaaggtaagggcctccattcactttgcttctccctacatttggggcat
ttagtgagacacttcagaattgcattgactccacaggctagcttctggaatttagaagtg
gaacaagaagcttttattggatctactttgttattatcttatgtccaccttgatccagaa
tatcctccaaatttctgcagggtcaaagttctggccaccataaataccatcctcctggat
acagggactcacccggcggacggttggaagggcgagcggccccgcagcgaggaggacaac
gagctgaacctccccaatctggcggctgcctacacgtccatcctgcgctcgctgggagaa
gacccccagcggcaggggctgctcaagacgccctggggcgcggccacggccatgcagttc
ttcaccaagggctaccaggagaccatctcagatgtcctcaacgacgctatctttgatgaa
gatcatgatgagatggtgattgtgaaggacatcgatatgttttctatgtgtgaacatcat
ctagttccatttattggaaaggtccatatcggttatcttcctaacaagcaagttcttggc
ctcagcaaacttgctagcacacttgagaatttgcatcctgtgtccactctggcttgtgaa
gtcaagttatatgaaggcaccaaaaattcaagatttgcaagggttaaactacaccatcca
tgggttcttcctgaaaaggtaccaccagattactctcccaattgccggaggaggaagatg
agacaaagcataatgcaaaagagacagacaacctattgtctactccttgaaaccatcttt
gttgccttgttttgtagacacatgtgtatggtaatgcgaggggtgcagaaaatgaacagt
agaaccgtgaccagcacaatgttgggggtgttccgggaggaccccaagacccgggaagag
tttctgactctcattaagagctga

DBGET integrated database retrieval system