KEGG   Sus scrofa (pig): 100622663Help
Entry
100622663         CDS       T01009                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ssc  Sus scrofa (pig)
Pathway
Inositol phosphate metabolism
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100622663 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100622663 (PIK3CB)
   04015 Rap1 signaling pathway
    100622663 (PIK3CB)
   04012 ErbB signaling pathway
    100622663 (PIK3CB)
   04370 VEGF signaling pathway
    100622663 (PIK3CB)
   04630 Jak-STAT signaling pathway
    100622663 (PIK3CB)
   04668 TNF signaling pathway
    100622663 (PIK3CB)
   04066 HIF-1 signaling pathway
    100622663 (PIK3CB)
   04068 FoxO signaling pathway
    100622663 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100622663 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100622663 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100622663 (PIK3CB)
   04024 cAMP signaling pathway
    100622663 (PIK3CB)
   04022 cGMP - PKG signaling pathway
    100622663 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100622663 (PIK3CB)
   04152 AMPK signaling pathway
    100622663 (PIK3CB)
   04150 mTOR signaling pathway
    100622663 (PIK3CB)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100622663 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    100622663 (PIK3CB)
  Cellular community
   04510 Focal adhesion
    100622663 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100622663 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100622663 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100622663 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100622663 (PIK3CB)
   04660 T cell receptor signaling pathway
    100622663 (PIK3CB)
   04662 B cell receptor signaling pathway
    100622663 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100622663 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100622663 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100622663 (PIK3CB)
   04062 Chemokine signaling pathway
    100622663 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    100622663 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    100622663 (PIK3CB)
   04915 Estrogen signaling pathway
    100622663 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100622663 (PIK3CB)
   04917 Prolactin signaling pathway
    100622663 (PIK3CB)
   04921 Oxytocin signaling pathway
    100622663 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100622663 (PIK3CB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100622663 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100622663 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100622663 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    100622663 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100622663 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100622663 (PIK3CB)
  Development
   04360 Axon guidance
    100622663 (PIK3CB)
   04380 Osteoclast differentiation
    100622663 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    100622663 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100622663 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100622663 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100622663 (PIK3CB)
   05231 Choline metabolism in cancer
    100622663 (PIK3CB)
   05205 Proteoglycans in cancer
    100622663 (PIK3CB)
   05203 Viral carcinogenesis
    100622663 (PIK3CB)
   05210 Colorectal cancer
    100622663 (PIK3CB)
   05212 Pancreatic cancer
    100622663 (PIK3CB)
   05214 Glioma
    100622663 (PIK3CB)
   05221 Acute myeloid leukemia
    100622663 (PIK3CB)
   05220 Chronic myeloid leukemia
    100622663 (PIK3CB)
   05218 Melanoma
    100622663 (PIK3CB)
   05211 Renal cell carcinoma
    100622663 (PIK3CB)
   05215 Prostate cancer
    100622663 (PIK3CB)
   05213 Endometrial cancer
    100622663 (PIK3CB)
   05224 Breast cancer
    100622663 (PIK3CB)
   05222 Small cell lung cancer
    100622663 (PIK3CB)
   05223 Non-small cell lung cancer
    100622663 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100622663 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100622663 (PIK3CB)
   04931 Insulin resistance
    100622663 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100622663 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100622663 (PIK3CB)
   05166 HTLV-I infection
    100622663 (PIK3CB)
   05162 Measles
    100622663 (PIK3CB)
   05164 Influenza A
    100622663 (PIK3CB)
   05161 Hepatitis B
    100622663 (PIK3CB)
   05160 Hepatitis C
    100622663 (PIK3CB)
   05169 Epstein-Barr virus infection
    100622663 (PIK3CB)
   05146 Amoebiasis
    100622663 (PIK3CB)
   05145 Toxoplasmosis
    100622663 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    100622663 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100622663 (PIK3CB)
   01522 Endocrine resistance
    100622663 (PIK3CB)
   01524 Platinum drug resistance
    100622663 (PIK3CB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100622663 (PIK3CB)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100622663 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 1070 aa AA seqDB search
MCFRFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPVKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDYPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRVISHIWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSIGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttccgcttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggctccatacctgtggatttccttttacccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcctatattaagcagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagctcgaagatgaaacaagaagactctgt
gatgtcaggccttttcttcctgttcttaaattagtaacaaggagttgtgacccaggggaa
aaattagactcaaaaattggagttcttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattgtcttggatggattggctaaagcaaacctatccaccagagcat
gaaccatctatccttgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtatttagctttcaagtatctcctaatatgaatcct
gtcaaaataaatgaattggcaatccaaaaacgtttgactattcatggcaaagaagatgaa
gttagcccctatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
taccccctaattcagttccagtatatccggaactgtgtaatgaacaggaccttaccccat
tttatacttgtggaatgttgcaagattaagaagctatatgaacaagaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttcctctgcctttaccaccaaagaaaact
cgagttatctctcatatttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcatatt
tggaatgaacccctggaatttgatatcaatacttgcgacctgccacgaatggctcgatta
tgttttgctgtttatgcagtgttagataaagtgaaaacgaagaaatcaaccaaaactatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtgcattatcctgtggcatgg
gtgaatacgatggtttttgactttaaaggacagttgcgatctggagatataatattacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattactaccctccttttgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtgggaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtctatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccgcgggaggccctggagcttctggatttcaactatccagatcagtacgtgcga
gaatatgctgttggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caattggtgcaagttttaaaatatgagccttttcttgactgtgccctctctagattccta
ctagaaagagcacttgctaatcggaggataggacagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgccgg
ggaagtgtaggtcacatgaaggcactttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctgaatagagccaaagggaaagag
gccatgcatacttgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cctctgaatccatgtgtcatcctctcagaactttatgttgaaaagtgtaaatatatggat
tccaaaatgaagcctttatggcttgtgtacaacaacaaggtgtttggtgaggattcaatt
ggagtgatttttaaaaatggtgatgacttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttaggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgatttcattcatgtgatccaacaaggaaaaacaggaaacacggaaaagtttggc
cggttccgccaatgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacaatatcttaaggactctcttgcattagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccatacagtgcgaaaagactacagatcttag

DBGET integrated database retrieval system