KEGG   Sus scrofa (pig): 100623101Help
Entry
100623101         CDS       T01009                                 

Gene name
SETD2
Definition
SET domain containing 2
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ssc00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 2396 aa AA seqDB search
MPNSPAVPLQVDSTPKIKTDIGDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLLTT
TTAVTSPPPPILPLPAVVAESTTVDSPPSSPPPPPPPPQAPAPSSPAPITEPVALPHTPV
TVLMTAPVNVAARALKEPPVIIVPESSEVDTKPYTVSNSSEEHITHNLSEQADIPSQKED
SHIGKEEEMPDSSKSSLGSKKTGSRKKSSQSEGTFLGSESDEDSIRTSSSQKSHDLKYSA
NIEKERDSKKNLAPLKSEDLGKSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRS
RSRSRSERGSRSSLSYSRSERSHYYDSDRRYHRSSPYRERARYSRLYTDNRARESSDSED
EYKKTYSRRTSSHSSSYRDLRTSSSYSKSDRDCKTESSYLEMEKRGKYSSKLERESKRTS
ENESVKRCCSPPNELGFRRGSSYSKHDTSASRYKSAPSRPIPKTDKFKNSFCCTELNEEI
RQSHSFGLQTPCSKGSELRMISKVPEKEKTESPSPSNRLNDSPTFKKLDESPIFKSEFIG
RDSHDSIKELDSLCKVKNDQLKSYCSTELNVNGSPGVESDLATFCTSKTDTVLMSSDDSV
TGLEVSPLVKACMISSNGFQNINRCKEKDNTCIQHTRSGSPFRETESLLLPHQDKLMCLP
VDYSNTVVKEPVDMRVSCCKTKDSDIYCTSNDSRPSLCHSEAENTEPLVTKISSNSFMDM
HLKSKTVICDNRNLTDQHSKFACGEYKQSVGSTSSASINHFDNLYQSAGSSCIASSLQTL
PPGIKVDSLPLLQCGDNTSPVLDAVLKSKSTEFLKHAEKETSIEVDGGLPDSGRGFASWE
NRHNNGLSGKCVQERQEEGNSILPDRKGRPEVSLDEEGGRGHAHTSDDSEVVFSSCDLNL
TMEDSDGVTYTLKCDSSGHASEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQ
SVVVVPKNSTLPMEETSPCSSRSSQSYRHYSDHWEDERLETRRHSYEEKFESITSKSCAQ
TEKFFLHKGTEKNPEISFTHPSRKQVDNHLPEITHPQSDGVDSTSHTDVKSDSLGRPNSE
EMVKAKIASRQQEELPVYSSDDFEDVPNKSRQQATFPKRPDSRLGKTELNFSSCEISRVD
GFRSSEELRNLGWDFSHQEKPTTTYQQPDSSYGSCGGHKYQQNTEQYGGTRNYWQGNGYW
DPRSAGRPPGTGVVYDQIQGQVPDSLTDDREEEENWDQHGGSHFSNQSNKFFLSLQKDKG
TVQAPEISSNSIKDSLAVNEKKDLSKNLERNDMKDRGPLKKRRQELDSESESDSELQDRK
KVRVEVEQGETAVPLGSALVGPSCVMEDFRDPQRWKEYAKQGKMPCYFDLIEENVYLTER
KKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQ
RKQHADVEVILTEKKGWGLRAAKDLPSTAHGNAIIDATQKGNCSRFMNHSCEPNCETQKI
LIKGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEG
LSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGD
GRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPVIQRWSQTKTAVPQLSEGDGYSSENT
SRAHTPLNTPDPSTKLSTEADIDTPKKVALRKLKIISENSMDSAISDATSELEGKDGKED
LDQLENVHVEEEEELQSQQLLTQQLPESKVDSEIAVEGSKLPTSEPEPDTEIEPKESNGT
KLDEPIAEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKK
SQTEKESTITERGRDAVGFRDQTVAPKTPNRSRERDPDKQTQNKEKRKRRGSLSPPSSAY
ERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTS
PLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHSQP
LVGHSTEALAAPPPVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSSVNVLPVPAPGPVQGQ
NYGVWDSNQQSVSVQQQYSPAQSQATIYYQGQTCPAVYGVTSPYSQTTPPIVQSYAQPSL
QYIQGQQIFTAHPQGVVVQPTAAVTTIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKT
IILPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENP
MKTSKKPKTAEADTSSELAKKSKEIFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHL
ARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7191 nt NT seq  +upstreamnt  +downstreamnt
atgcctaactcaccagctgtacctcttcaagtagactcgacccctaaaattaaaacagac
attggagatacattatctactacagaagaatcttccccaccaaaatcaagggtagaattg
ggcaaaattcattttaagaaacatctgcttcatgtaacatccaggccactgctgactact
accacagcagtgacatctccacctcctcccatactaccattaccagcagtcgtagcagaa
tcaacaactgtagactcaccaccctcatctccacctccaccacctccacctccccaagcc
ccagcaccctcatcaccagcaccaataacagagccagtggccttgccacacacaccagta
acagttctgatgacagcaccagtcaacgtagcagctagagccttgaaggaaccaccagtt
ataattgttccagaatcatcagaagtggacactaagccgtacactgtatctaatagttca
gaagaacatataactcacaatttgagtgagcaagcagatattccttcacaaaaagaagat
tcccacattgggaaggaagaagaaatgccagatagttctaagagtagtctgggctctaaa
aaaacaggttctaggaagaaatcctcacaatctgaaggcacctttcttggttcagaatct
gatgaagattctatacggacttcctcaagtcaaaaatcacatgatttaaaatattcagca
aacattgaaaaagaaagagattcaaaaaagaacttagcacctttaaaaagtgaggattta
ggaaaatcttcacgatctaaaacagagagagatgataaatattttagctattcaaagctt
gaaagagacactcggtatatatcttctcgctgtagatcagagagggagagaagacggagc
agatctcgttctagatctgagagaggctctcgatctagtttatcctattccaggtcggaa
cgatcccattattatgactctgatcgtcgctaccacagaagttccccttatcgagagagg
gcacgctattctcggctatatacagacaacagagcacgagagagttctgactcagaagat
gagtataagaagacatactcaagacgcacctcatctcattcttcctcttacagagaccta
aggacatcatcatcctattctaaatctgatcgggactgtaaaactgagtcctcctattta
gagatggagaaaagaggaaagtattcatcaaaattagaaagagaatccaaaaggacttca
gaaaatgaatcagtgaaaaggtgttgttctccccctaatgaactaggattccgtcggggg
tcatcatattctaagcatgataccagtgcttcccgttataaatctgccccttcaagacct
atacccaaaactgataaatttaaaaattctttctgttgtacagaattgaatgaggaaatc
agacagtctcattcttttggtttacagactccttgttcaaaaggtagtgaattaagaatg
attagtaaagttcctgaaaaagaaaagactgagtctccatctccatcaaatcgattaaat
gattcacctacttttaaaaagctagatgaatcgcctatttttaagtctgagtttatagga
cgcgatagccatgatagtattaaggaattagactctttatgtaaagtgaagaatgatcaa
ttaaaaagttattgttccacagaattaaatgtaaatggatctcctggtgtggaatctgat
ttggcaacattttgcacttctaaaactgacactgttttgatgtcttctgatgatagtgtg
actggattggaggtatcccccttggtcaaagcatgcatgatttcatcaaatggatttcaa
aatattaatagatgtaaagaaaaagataatacttgcattcagcatactaggtcaggaagc
ccatttagagaaacagaatctctattattgccacaccaagataaactcatgtgtttgcca
gtagattattctaacacagtagtgaaagaaccagttgatatgagagtttcttgctgtaaa
accaaagattcagatatatactgtacttcaaatgacagccgtccttctttgtgtcattcc
gaagctgaaaatactgagcctttagttacgaagatttcttcaaatagctttatggatatg
catttgaaatcaaaaacagttatatgtgataatagaaatctgacagatcagcactcaaaa
tttgcatgtggagaatataagcagagtgttggtagtactagttcagcttctattaatcat
tttgataatttatatcaatctgcagggagctcatgtattgcttcatctcttcagactctt
ccaccaggaataaaagtggacagtttacctctcttgcagtgtggagataacacatctcca
gttttggatgctgtgctaaagagtaaaagcacagagtttttaaagcatgcagagaaagaa
acatcaatagaagtagatggtggccttcctgattcaggaagggggtttgcctcctgggaa
aacaggcataataatgggttatctgggaaatgtgtgcaagagcgtcaagaagaagggaat
tccatattgcctgatagaaaaggaagaccagaagtctctttagatgaggaaggtggaaga
ggacatgcacatacttctgatgattcagaagttgtgttttcttcttgtgatttgaattta
accatggaggacagtgatggtgtaacatataccttaaaatgtgacagtagtggtcatgcc
tcagagattgtatctactgtccatgaagattattctggttcttcagaaagttcaagtgat
gaaagtgattcagaagatacagattctgatgatagcagtattccaagaaaccgccttcag
tctgttgtggttgtgccaaagaattctactttgcccatggaagaaacaagtccttgttct
tctcggagcagtcagagttacagacactattctgaccactgggaagatgagagattggag
acaagaagacattcatatgaggaaaaatttgagagtataacaagtaaatcttgcgctcag
actgagaagttcttccttcataaaggaacagagaagaatccagaaatttcttttacacac
cccagccgaaaacaagtagataatcacctgcctgaaattactcatcctcagagtgatggg
gttgatagtacaagtcatacagatgtgaaatctgactcccttggtcgtccaaattctgag
gaaatggtgaaagccaaaatagcttctaggcagcaagaagagctaccagtttattcttct
gatgattttgaagatgtcccaaataagtctcggcaacaggccactttccctaagaggcca
gatagtagactgggaaaaacagagttgaatttttcttcttgtgagatctcccgggtggat
ggtttccgttcatcagaagaactcagaaatcttgggtgggacttctctcaccaagaaaag
cctactaccacatatcagcaacctgacagcagttatggatcctgtggtggacacaagtat
cagcaaaacacagaacagtatggtgggacacgtaattactggcagggcaatggctactgg
gatccaagatcagcaggtagacctcctggaactggggttgtatatgatcaaattcaagga
caggtaccagattccttaacagatgatcgtgaagaggaggagaattgggatcaacatgga
ggatctcacttttcaaaccagtccaataaattttttctatcacttcagaaggacaagggg
acagtgcaggcacctgaaataagtagcaattccattaaagactctttagctgtgaatgaa
aagaaagatctttcaaaaaacttagaaagaaatgatatgaaagatagagggcctcttaaa
aaaaggagacaggaattggacagtgaatctgaaagtgatagtgagcttcaggacagaaag
aaagttagagtggaggtagagcagggagagacagcagtgcccctaggctcagcactggtt
ggtccttcttgtgttatggaggacttcagggacccacagcggtggaaggaatatgccaag
caagggaagatgccttgttactttgatctgattgaagaaaatgtttatttaacagaaaga
aagaagaataaatcccatcgggatattaagcgaatgcagtgtgagtgtacacctctttct
aaagatgaaagagctcaaggtgaaatagcttgtggggaagattgtcttaatcgactcctc
atgattgaatgttcttctcggtgtccaaatggggattattgttccaatagacggtttcag
agaaaacagcatgcagatgtggaagtcatactcacagaaaagaaaggctggggcttgaga
gctgctaaagaccttccttccacagctcacggcaacgccataatagatgctactcagaaa
ggaaattgctcccggttcatgaatcacagctgtgagccaaactgcgagactcaaaaaatt
ctgatcaaagggaaagaagcacagaaatgtttctgtgggtcggctaattgccggggttac
ctgggaggagagaacagagtcagcatcagagcagcaggagggaaaatgaagaaagaacga
tctcgtaagaaggattcagtggatggagagctagaagctctgatggagaatggtgagggt
ctctctgataaaaatcaggtgctcagcttatcccggctaatggttagaattgaaactttg
gagcagaaacttacctgtctcaagctcatacagaacacacattcacaatcttgcctgaag
tcctttctggaacgacatgggctgtctttgttgtggatctggatggcagagctaggtgat
ggccgggaaagtaaccagaagcttcaggaagagattataaagactttggaacatttgcct
attcctactaaaaatatgttggaggaaagcaaagtacttccagttattcaacgttggtct
cagaccaagactgctgtccctcagctgagtgaaggagatgggtattccagtgagaatacg
tcacgtgctcacacaccactcaacacacctgatccttccaccaagttgagcacagaagct
gacatagacacccccaagaaggtagcgttgcgcaaacttaaaattataagtgaaaatagc
atggacagtgcaatctctgatgctaccagtgagctagaaggcaaggatggcaaagaggac
cttgaccagttagaaaatgttcatgtagaagaagaggaagagttacagtcacaacagcta
ctcacacaacagttgcctgaatctaaagttgatagtgaaattgctgtggagggcagtaag
ctacccacatctgaaccagagcctgacactgaaatagagcctaaagagagcaatggcaca
aaactagatgaacctatcgctgaggaaacaccatctcaagatgaagaggaaggtgtatct
gatgtggaaagtgagaggagccaggaacagccagataaaacagtagatataagtgatttg
gccaccaagctcctggacagttggaaagacctaaaggaagtatatcgaattccaaagaaa
agtcaaactgaaaaggagagcacaataactgaacgaggaagggatgctgttggcttcaga
gatcaaacagttgccccaaagactcctaacaggtcaagagagagagacccagacaaacaa
actcaaaataaagagaaaaggaaacgaaggggctccctctcaccaccttcttctgcctat
gagcggggaacaaaaaggccagatgacagatatgatacaccaacttctaaaaagaaagta
cgaattaaagatcgcaataaactttctacggaggagcgtcggaagctgtttgagcaagag
gtagctcagcgggaggctcagaaacagcaacagcagatgcagaacctgggaatgacgtct
ccactgccctatgactctcttggctacaatgcccctcatcatccctttgctggctaccca
ccaggttatcccatgcaggcctatgtggatcccagcaatcctaatgctggaaaggtgctc
cttcccacacccagcatggatcctgtgtgttctcctgctccttatgatcattctcagccc
ttggtgggacattctacagaggcccttgctgctcctccacccgtgccggtggtgccacat
gtggcagcccctgtggaagtttccagttcacagtatgtggcccaaagtgatggtgtggta
caccaagactccagtgtcaacgtcttgccggtgccagccccaggcccagtccagggacag
aattatggtgtttgggattcaaaccaacagtccgtcagtgtacagcagcagtattctcct
gcacaatctcaagcaaccatatattatcaaggacagacttgtccagctgtctatggtgtg
acatcaccttattcacagacaactccaccaattgtacagagttatgcccagccaagtctt
cagtacatccagggacaacagattttcacagcccacccacaaggagtggtggtacagcca
actgcggccgtgactacaatagttgcaccagggcagcctcagcccttacagccacctgaa
atggttgtgacaaataatctcctggatctaccacccccatctcctcccaaaccaaaaacc
atcatcttacctcccaactggaagactgcccgagacccagaagggaagatttactactac
catgtgatcacaaggcagactcagtgggatcctcctacttgggaaagcccaggagatgat
gccagccttgagcatgaagctgagatggacttaggaaccccaacatatgatgagaatccc
atgaagacctcaaaaaagcccaagacagcagaagcagacacctccagtgagctggctaag
aaaagcaaagaaatattcagaaaagagatgtcccagttcatcgtccagtgcctgaaccct
taccggaaacctgactgcaaagtgggaagaattactacaactgaagacttcaaacaccta
gctcgcaagctgactcatggcgttatgaataaggagctgaagtactgtaagaacccggag
gacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtacattaagaagtatatg
cagaagtttggggctgtttacaaacccaaagaggatactgaattggagtga

DBGET integrated database retrieval system