KEGG   Sus scrofa (pig): 100623101Help
Entry
100623101         CDS       T01009                                 

Gene name
SETD2
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100623101 (SETD2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100623101 (SETD2)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100623101 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 2558 aa AA seqDB search
MKQLPPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPIFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDMPNSPAVPLQVDSTPKIKTDI
GDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLLTTTTAVTSPPPPILPLPAVVAES
TTVDSPPSSPPPPPPPPQAPAPSSPAPITEPVALPHTPVTVLMTAPVNVAARALKEPPVI
IVPESSEVDTKPYTVSNSSEEHITHNLSEQADIPSQKEDSHIGKEEEMPDSSKSSLGSKK
TGSRKKSSQSEGTFLGSESDEDSIRTSSSQKSHDLKYSANIEKERDSKKNLAPLKSEDLG
KSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRSRSRSRSERGSRSSLSYSRSER
SHYYDSDRRYHRSSPYRERARYSRLYTDNRARESSDSEDEYKKTYSRRTSSHSSSYRDLR
TSSSYSKSDRDCKTESSYLEMEKRGKYSSKLERESKRTSENESVKRCCSPPNELGFRRGS
SYSKHDTSASRYKSAPSRPIPKTDKFKNSFCCTELNEEIRQSHSFGLQTPCSKGSELRMI
SKVPEKEKTESPSPSNRLNDSPTFKKLDESPIFKSEFIGRDSHDSIKELDSLCKVKNDQL
KSYCSTELNVNGSPGVESDLATFCTSKTDTVLMSSDDSVTGLEVSPLVKACMISSNGFQN
INRCKEKDNTCIQHTRSGSPFRETESLLLPHQDKLMCLPVDYSNTVVKEPVDMRVSCCKT
KDSDIYCTSNDSRPSLCHSEAENTEPLVTKISSNSFMDMHLKSKTVICDNRNLTDQHSKF
ACGEYKQSVGSTSSASINHFDNLYQSAGSSCIASSLQTLPPGIKVDSLPLLQCGDNTSPV
LDAVLKSKSTEFLKHAEKETSIEVDGGLPDSGRGFASWENRHNNGLSGKCVQERQEEGNS
ILPDRKGRPEVSLDEEGGRGHAHTSDDSEVVFSSCDLNLTMEDSDGVTYTLKCDSSGHAS
EIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSS
RSSQSYRHYSDHWEDERLETRRHSYEEKFESITSKSCAQTEKFFLHKGTEKNPEISFTHP
SRKQVDNHLPEITHPQSDGVDSTSHTDVKSDSLGRPNSEEMVKAKIASRQQEELPVYSSD
DFEDVPNKSRQQATFPKRPDSRLGKTELNFSSCEISRVDGFRSSEELRNLGWDFSHQEKP
TTTYQQPDSSYGSCGGHKYQQNTEQYGGTRNYWQGNGYWDPRSAGRPPGTGVVYDQIQGQ
VPDSLTDDREEEENWDQHGGSHFSNQSNKFFLSLQKDKGTVQAPEISSNSIKDSLAVNEK
KDLSKNLERNDMKDRGPLKKRRQELDSESESDSELQDRKKVRVEVEQGETAVPLGSALVG
PSCVMEDFRDPQRWKEYAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSK
DERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRA
AKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRF
MNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCR
GYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIE
TLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEH
LPIPTKNMLEESKVLPVIQRWSQTKTAVPQLSEGDGYSSENTSRAHTPLNTPDPSTKLST
EADIDTPKKVALRKLKIISENSMDSAISDATSELEGKDGKEDLDQLENVHVEEEEELQSQ
QLLTQQLPESKVDSEIAVEGSKLPTSEPEPDTEIEPKESNGTKLDEPIAEETPSQDEEEG
VSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKESTITERGRDAVG
FRDQTVAPKTPNRSRERDPDKQTQNKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKK
KVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPHHPFAG
YPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHSQPLVGHSTEALAAPPPVPVV
PHVAAPVEVSSSQYVAQSDGVVHQDSSVNVLPVPAPGPVQGQNYGVWDSNQQSVSVQQQY
SPAQSQATXYYQGQTCPAVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVV
QPTAAVTTIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIILPPNWKTARDPEGKIY
YYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSEL
AKKSKEIFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKN
PEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7677 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgccgccgcagccgcctccgaagatgggggatttctacgaccccgagcac
ccgacccctgaagaagaagaaaatgaggcaaagattgaaaatgtacagaaaacaggtttc
atcaaaggaccaatattcaaaggtgttgcttctagtcgttttttgcccaaaggcaccaag
acaaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttcagccttaca
aagaaaactttgcagaacaggtttctgactgcacttggcaatgagaagcaaaatgatatg
cctaactcaccagctgtacctcttcaagtagactcgacccctaaaattaaaacagacatt
ggagatacattatctactacagaagaatcttccccaccaaaatcaagggtagaattgggc
aaaattcattttaagaaacatctgcttcatgtaacatccaggccactgctgactactacc
acagcagtgacatctccacctcctcccatactaccattaccagcagtcgtagcagaatca
acaactgtagactcaccaccctcatctccacctccaccacctccacctccccaagcccca
gcaccctcatcaccagcaccaataacagagccagtggccttgccacacacaccagtaaca
gttctgatgacagcaccagtcaacgtagcagctagagccttgaaggaaccaccagttata
attgttccagaatcatcagaagtggacactaagccgtacactgtatctaatagttcagaa
gaacatataactcacaatttgagtgagcaagcagatattccttcacaaaaagaagattcc
cacattgggaaggaagaagaaatgccagatagttctaagagtagtctgggctctaaaaaa
acaggttctaggaagaaatcctcacaatctgaaggcacctttcttggttcagaatctgat
gaagattctatacggacttcctcaagtcaaaaatcacatgatttaaaatattcagcaaac
attgaaaaagaaagagattcaaaaaagaacttagcacctttaaaaagtgaggatttagga
aaatcttcacgatctaaaacagagagagatgataaatattttagctattcaaagcttgaa
agagacactcggtatatatcttctcgctgtagatcagagagggagagaagacggagcaga
tctcgttctagatctgagagaggctctcgatctagtttatcctattccaggtcggaacga
tcccattattatgactctgatcgtcgctaccacagaagttccccttatcgagagagggca
cgctattctcggctatatacagacaacagagcacgagagagttctgactcagaagatgag
tataagaagacatactcaagacgcacctcatctcattcttcctcttacagagacctaagg
acatcatcatcctattctaaatctgatcgggactgtaaaactgagtcctcctatttagag
atggagaaaagaggaaagtattcatcaaaattagaaagagaatccaaaaggacttcagaa
aatgaatcagtgaaaaggtgttgttctccccctaatgaactaggattccgtcgggggtca
tcatattctaagcatgataccagtgcttcccgttataaatctgccccttcaagacctata
cccaaaactgataaatttaaaaattctttctgttgtacagaattgaatgaggaaatcaga
cagtctcattcttttggtttacagactccttgttcaaaaggtagtgaattaagaatgatt
agtaaagttcctgaaaaagaaaagactgagtctccatctccatcaaatcgattaaatgat
tcacctacttttaaaaagctagatgaatcgcctatttttaagtctgagtttataggacgc
gatagccatgatagtattaaggaattagactctttatgtaaagtgaagaatgatcaatta
aaaagttattgttccacagaattaaatgtaaatggatctcctggtgtggaatctgatttg
gcaacattttgcacttctaaaactgacactgttttgatgtcttctgatgatagtgtgact
ggattggaggtatcccccttggtcaaagcatgcatgatttcatcaaatggatttcaaaat
attaatagatgtaaagaaaaagataatacttgcattcagcatactaggtcaggaagccca
tttagagaaacagaatctctattattgccacaccaagataaactcatgtgtttgccagta
gattattctaacacagtagtgaaagaaccagttgatatgagagtttcttgctgtaaaacc
aaagattcagatatatactgtacttcaaatgacagccgtccttctttgtgtcattccgaa
gctgaaaatactgagcctttagttacgaagatttcttcaaatagctttatggatatgcat
ttgaaatcaaaaacagttatatgtgataatagaaatctgacagatcagcactcaaaattt
gcatgtggagaatataagcagagtgttggtagtactagttcagcttctattaatcatttt
gataatttatatcaatctgcagggagctcatgtattgcttcatctcttcagactcttcca
ccaggaataaaagtggacagtttacctctcttgcagtgtggagataacacatctccagtt
ttggatgctgtgctaaagagtaaaagcacagagtttttaaagcatgcagagaaagaaaca
tcaatagaagtagatggtggccttcctgattcaggaagggggtttgcctcctgggaaaac
aggcataataatgggttatctgggaaatgtgtgcaagagcgtcaagaagaagggaattcc
atattgcctgatagaaaaggaagaccagaagtctctttagatgaggaaggtggaagagga
catgcacatacttctgatgattcagaagttgtgttttcttcttgtgatttgaatttaacc
atggaggacagtgatggtgtaacatataccttaaaatgtgacagtagtggtcatgcctca
gagattgtatctactgtccatgaagattattctggttcttcagaaagttcaagtgatgaa
agtgattcagaagatacagattctgatgatagcagtattccaagaaaccgccttcagtct
gttgtggttgtgccaaagaattctactttgcccatggaagaaacaagtccttgttcttct
cggagcagtcagagttacagacactattctgaccactgggaagatgagagattggagaca
agaagacattcatatgaggaaaaatttgagagtataacaagtaaatcttgcgctcagact
gagaagttcttccttcataaaggaacagagaagaatccagaaatttcttttacacacccc
agccgaaaacaagtagataatcacctgcctgaaattactcatcctcagagtgatggggtt
gatagtacaagtcatacagatgtgaaatctgactcccttggtcgtccaaattctgaggaa
atggtgaaagccaaaatagcttctaggcagcaagaagagctaccagtttattcttctgat
gattttgaagatgtcccaaataagtctcggcaacaggccactttccctaagaggccagat
agtagactgggaaaaacagagttgaatttttcttcttgtgagatctcccgggtggatggt
ttccgttcatcagaagaactcagaaatcttgggtgggacttctctcaccaagaaaagcct
actaccacatatcagcaacctgacagcagttatggatcctgtggtggacacaagtatcag
caaaacacagaacagtatggtgggacacgtaattactggcagggcaatggctactgggat
ccaagatcagcaggtagacctcctggaactggggttgtatatgatcaaattcaaggacag
gtaccagattccttaacagatgatcgtgaagaggaggagaattgggatcaacatggagga
tctcacttttcaaaccagtccaataaattttttctatcacttcagaaggacaaggggaca
gtgcaggcacctgaaataagtagcaattccattaaagactctttagctgtgaatgaaaag
aaagatctttcaaaaaacttagaaagaaatgatatgaaagatagagggcctcttaaaaaa
aggagacaggaattggacagtgaatctgaaagtgatagtgagcttcaggacagaaagaaa
gttagagtggaggtagagcagggagagacagcagtgcccctaggctcagcactggttggt
ccttcttgtgttatggaggacttcagggacccacagcggtggaaggaatatgccaagcaa
gggaagatgccttgttactttgatctgattgaagaaaatgtttatttaacagaaagaaag
aagaataaatcccatcgggatattaagcgaatgcagtgtgagtgtacacctctttctaaa
gatgaaagagctcaaggtgaaatagcttgtggggaagattgtcttaatcgactcctcatg
attgaatgttcttctcggtgtccaaatggggattattgttccaatagacggtttcagaga
aaacagcatgcagatgtggaagtcatactcacagaaaagaaaggctggggcttgagagct
gctaaagaccttccttcgaacacttttgtcctggaatattgtggagaggtacttgatcat
aaagagtttaaagcccgggtaaaggagtatgctcgaaacaaaaacatccactactatttc
atggccctgaagaatgatgagataatagatgctactcagaaaggaaattgctcccggttc
atgaatcacagctgtgagccaaactgcgagactcaaaaatggactgtgaacggacaactg
agagttgggttttttaccaccaaactggttccttcaggctcagagttaacatttgactat
cagttccaaagatatgggaaagaagcacagaaatgtttctgtgggtcggctaattgccgg
ggttacctgggaggagagaacagagtcagcatcagagcagcaggagggaaaatgaagaaa
gaacgatctcgtaagaaggattcagtggatggagagctagaagctctgatggagaatggt
gagggtctctctgataaaaatcaggtgctcagcttatcccggctaatggttagaattgaa
actttggagcagaaacttacctgtctcaagctcatacagaacacacattcacaatcttgc
ctgaagtcctttctggaacgacatgggctgtctttgttgtggatctggatggcagagcta
ggtgatggccgggaaagtaaccagaagcttcaggaagagattataaagactttggaacat
ttgcctattcctactaaaaatatgttggaggaaagcaaagtacttccagttattcaacgt
tggtctcagaccaagactgctgtccctcagctgagtgaaggagatgggtattccagtgag
aatacgtcacgtgctcacacaccactcaacacacctgatccttccaccaagttgagcaca
gaagctgacatagacacccccaagaaggtagcgttgcgcaaacttaaaattataagtgaa
aatagcatggacagtgcaatctctgatgctaccagtgagctagaaggcaaggatggcaaa
gaggaccttgaccagttagaaaatgttcatgtagaagaagaggaagagttacagtcacaa
cagctactcacacaacagttgcctgaatctaaagttgatagtgaaattgctgtggagggc
agtaagctacccacatctgaaccagagcctgacactgaaatagagcctaaagagagcaat
ggcacaaaactagatgaacctatcgctgaggaaacaccatctcaagatgaagaggaaggt
gtatctgatgtggaaagtgagaggagccaggaacagccagataaaacagtagatataagt
gatttggccaccaagctcctggacagttggaaagacctaaaggaagtatatcgaattcca
aagaaaagtcaaactgaaaaggagagcacaataactgaacgaggaagggatgctgttggc
ttcagagatcaaacagttgccccaaagactcctaacaggtcaagagagagagacccagac
aaacaaactcaaaataaagagaaaaggaaacgaaggggctccctctcaccaccttcttct
gcctatgagcggggaacaaaaaggccagatgacagatatgatacaccaacttctaaaaag
aaagtacgaattaaagatcgcaataaactttctacggaggagcgtcggaagctgtttgag
caagaggtagctcagcgggaggctcagaaacagcaacagcagatgcagaacctgggaatg
acgtctccactgccctatgactctcttggctacaatgcccctcatcatccctttgctggc
tacccaccaggttatcccatgcaggcctatgtggatcccagcaatcctaatgctggaaag
gtgctccttcccacacccagcatggatcctgtgtgttctcctgctccttatgatcattct
cagcccttggtgggacattctacagaggcccttgctgctcctccacccgtgccggtggtg
ccacatgtggcagcccctgtggaagtttccagttcacagtatgtggcccaaagtgatggt
gtggtacaccaagactccagtgtcaacgtcttgccggtgccagccccaggcccagtccag
ggacagaattatggtgtttgggattcaaaccaacagtccgtcagtgtacagcagcagtat
tctcctgcacaatctcaagcaacantatattatcaaggacagacttgtccagctgtctat
ggtgtgacatcaccttattcacagacaactccaccaattgtacagagttatgcccagcca
agtcttcagtacatccagggacaacagattttcacagcccacccacaaggagtggtggta
cagccaactgcggccgtgactacaatagttgcaccagggcagcctcagcccttacagcca
cctgaaatggttgtgacaaataatctcctggatctaccacccccatctcctcccaaacca
aaaaccatcatcttacctcccaactggaagactgcccgagacccagaagggaagatttac
tactaccatgtgatcacaaggcagactcagtgggatcctcctacttgggaaagcccagga
gatgatgccagccttgagcatgaagctgagatggacttaggaaccccaacatatgatgag
aatcccatgaagacctcaaaaaagcccaagacagcagaagcagacacctccagtgagctg
gctaagaaaagcaaagaaatattcagaaaagagatgtcccagttcatcgtccagtgcctg
aacccttaccggaaacctgactgcaaagtgggaagaattactacaactgaagacttcaaa
cacctagctcgcaagctgactcatggcgttatgaataaggagctgaagtactgtaagaac
ccggaggacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtacattaagaag
tatatgcagaagtttggggctgtttacaaacccaaagaggatactgaattggagtga

DBGET integrated database retrieval system