KEGG   Sus scrofa (pig): 100623494Help
Entry
100623494         CDS       T01009                                 

Definition
maltase-glucoamylase, intestinal-like
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ssc  Sus scrofa (pig)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100623494
   00500 Starch and sucrose metabolism
    100623494
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100623494
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100623494
    3.2.1.20  alpha-glucosidase
     100623494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 2260 aa AA seqDB search
MRGPRKSSRPTSANHAFSTQSLPSALSGAEHYNSQQAVDPPLRRRRSEPGRAREEIPPLL
LEGSKPHLEEQTLGIHSHPRIIPTXTEDVCRWRYKCCWKPVANTDIPWCFFPRNWGYEVS
SWVKNTSTVLSAQLRRLPSPSLFGNDVIDTLFTAEYQTSNRFHFKVTDFNNIRYEVPHES
VRLFDDGAADTSNSSYHVEIVNKPFSVKIMRTSNQRVLLDTSIGPLQVAQQYLQLSFRLP
SANVYGLGEHVHQQYRHSMAWRTWPIFTRDATPTQGMINLYGAHPFFLCLEDTSGYSFGV
FLMNSNAMEVTLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLG
FQLSRRDYGGIDGLKKVVNRNRAAEIPYDVQYSDVDYMDGKKDFTVDGVAFYNLSGFVRE
LHSYGLKYVIMMHPGIVNNSDYPPYVNGREKRVWILGNKGAVIGQGYPGWTVFPDFSNPA
CTEWWKDQFVEFNSTLEFDGVWIEMDEVSSFLQSPDHECELNNLNFPPFTPRVVDRLLFA
RTLCMDAEFHEGLHYDVHSLYGYFMARATDRAMEAILSNKRGFILSRSTFAGSGTFAGHW
LGDNAATWDDLRWSIPSILEFNLFGIPMVGANICGYTENVTEELCRRWMQLGAFYPLSRN
HNGPGFRDQDPAAFSENNSTLLNSARHYLNIRYTLLPYLYTLFYRAHSLGETVARPLVHE
FYQDPATWEVHEQFLWGPGLLITPVLYEGVDSAKAYIPDAIWYDYETGVATQWRKQFVEM
LLPGDRIGLHLRGGYIFPTQQPNTTTEASRRNSLGLIIALDYKREAKGQLYWDDGSLSDA
VAQNKYILYDFSVTSNRLQAKIIKNTYTDPNGLTFTNITILGMDKEPANFTVFLNNAATP
ISNVVYTSSTKVVSIPDLQGLLLGQEFSIEWNLPVHDLQKFNCYPEEPAVSEENCQQRGC
LWEPTTVPGVPTCFYDTIPNYAASNIQYLPTGITTDLSHLTAPESAAPPSSRGEQIQPPV
AAAAAKAASASDPLSAKISFLRVSVIYHTATMLQFKIYDPTNKRYEVPVSLNTPPSPVGS
TADRLYDVRIQNNPFGIQIRRKSSGTVIWDSQLPGFTFNDLFLSISTRLPSQYLYGFGET
EHTTFRRNMSWHMWGMFARDEPPAYKKNSYGVHPYYMALEGDGNAHGVLLLNSNAMDVTF
QPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGQPAMVPYWALGFQLSRYGYQNDA
EISNLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIEQMKKNGMRFILILD
PAISGNETQYLTFTRGQENNVFIKWPDNSDIVWGKVWPDLPNVNVDGSLDPDTQVKLYRA
HVAFPDFLRNSTAAWWKKEIEELYRNPREPEKSLKFDGLWIDMNEPSNFVDGSVTGCSDD
VLNNPPYMPHLESRDGGLSNKTLCMESQQILPDGSPVRHYDVHSLYGWSQTRPTYEAVQE
VTGQRGVVITRSTFPSSGRWSGHWLGDNTAAWDQLRKSIIGMMEFSLFGVPYTGADICGF
FGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWNSTFEMFSRKVLQTRYALLPYL
YTLMHKAHVEGSTVVRPLLHEFTKDATTWDIDQQFMLGPAVLISPVLESNTFQILAYFPR
ARWYDYSTESGSESPGEWKILAAPLDHINLHIRGGYILPWQEPAMNTFSSRQKFMGLIVA
LDSSGRADGQIFWDDGQSIDTYENGNYFLANFTAAQNVLQIQTIHNKYLSDSNPLKVGYI
RIWGINSTYVTQVTLTYDNQQFVVMTFKSDPYNQTLTIQLTDKIISLEKLTEISWIHGGP
IVSTTPMMSTFPKSSSYPPTFTTRATPSETISTSSATTSTATASSIVTLPVTTTPFLTNA
TQVPTGTTVPDNVTSSPTNATSAGIIVTLPVTITSFPTGTPEVPPGTTDLNNITSSPKNI
TTASTDVTLPFTPTPFPTGTPEVPTGPSILNTTTSSPTNTTTPSTNVTPPVTIMPFPTST
TEISTGTTVPANTTASPTNATTASADVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNI
TTASTDVTLPFTPTPFPTATPEVPTGPSILNTTTSSPTNTTTPSTNVTPPVTIMPFPTST
TEISTGTTVPANTTASPTNATTASADVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNT
TTAGTVVTLPVTTTPFLTNATQVPTGTTVPDNVTSPHKSP
NT seq 6781 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggacccagaaagtccagccgccccacctctgcaaaccacgccttcagcacccag
tccctgccctccgcgctctcaggcgccgagcactacaactcccagcaggccgtggacccg
ccgctgcgccggcggcgctctgagccgggacgagccagggaggagattccgcccctgctg
ctggaaggcagcaagccccacctggaagagcagacgctgggcatccactcgcatcctaga
atcatccctactntgacagaggatgtctgcagatggagatataagtgctgctggaagcct
gtcgcaaacactgatatcccttggtgcttcttccccagaaactggggctatgaagtcagc
agttgggttaaaaatacaagcacagtgctttctgcccagttgagaaggttgccgtccccg
tccctgtttggaaatgacgtcatcgacaccctcttcacagctgagtaccagacatccaat
cgttttcatttcaaggtcactgatttcaataacatacgctatgaagtcccccatgaaagt
gtcaggctgttcgacgatggggctgctgatacctccaattcgagctatcacgtagaaatc
gttaacaaacccttcagcgtcaaaattatgaggacgagcaaccagagagtcttgctggac
acaagcatcgggcccctgcaggttgcccagcagtatctgcagctgtccttccggctaccc
agcgccaacgtgtacgggctgggagaacacgtgcaccaacagtaccgccacagcatggcc
tggaggacctggcccatcttcacccgggatgccacccccacccagggtatgattaatctg
tatggagctcacccattcttcctgtgccttgaagacaccagcggctactcttttggggtt
tttctgatgaacagtaatgccatggaggtcaccctccagcccgctcctgctatcacttat
cgtaccactgggggcattctcgacttctacgtgttcctgggaaatactccagaacaggtg
gttcaggagtatctggagcttgttggacgaccattcttgcctccctactggagtcttggg
ttccagcttagtcgtagggattatggtggcatcgacgggttgaaaaaagttgtaaaccga
aatcgtgcagctgagatcccatatgatgtccagtactctgatgtagactacatggatgga
aagaaggatttcactgttgatggagtggctttctataatctctcaggttttgtcagagag
ttacatagctatggattgaaatatgtaattatgatgcatcctggcatcgtaaataactct
gactacccgccttatgtgaatggaagagaaaagagagtgtggatcttggggaacaaaggt
gctgtcattgggcaggggtacccaggatggacagtctttcctgacttcagtaatccagct
tgcactgaatggtggaaagaccagttcgttgaatttaacagtactctggagtttgatgga
gtgtggattgaaatggatgaagtatccagcttcctccaaagtcctgatcatgagtgtgaa
ctgaacaacttgaactttcctcctttcactcctcgtgtcgtggaccgcttgctttttgca
agaaccctctgcatggacgctgagtttcacgagggccttcactatgatgtccacagcctg
tatggctacttcatggcaagagccacagacagggcgatggaggccatcctctccaataaa
agaggcttcatcctgtcccgttctacttttgccggatctggcacatttgctggtcattgg
ctgggggacaacgcagccacatgggatgatctccgatggtccattcccagtatcctggaa
ttcaacctatttggcattcccatggtgggcgccaacatctgtggttatacagaaaatgtc
acagaggaactctgcagaaggtggatgcagcttggagcattttatccgctatcgaggaat
cacaacgggcctgggttcagggaccaggatccggctgcctttagtgaaaacaactcaacg
ctgttgaattccgccagacactatttgaacatccgctacaccctgctgccctatctctac
acccttttctaccgagctcattccttgggggagaccgtagccaggcccctcgtccatgag
ttctaccaggacccagccacgtgggaggtgcacgagcagttcctctgggggcctggactc
ctcatcacgcctgttttatatgaaggtgtggactctgcaaaagcgtacataccggacgcc
atctggtacgactatgagactggagtagccacccaatggaggaaacaatttgtggagatg
ctactgccaggtgacaggataggacttcaccttcgagggggctacatctttcccacccag
cagccaaacacaaccacagaggccagtcggaggaattccctgggactcatcattgccttg
gactataagagagaagcaaaggggcagctgtactgggatgacggttctctttcagatgct
gtagctcaaaacaaatacattctgtatgatttttctgtcacctctaaccgtctccaggca
aagattataaaaaatacgtacacagaccccaacggactcacatttacaaatatcacaatc
ttgggaatggacaaggaacctgctaattttactgtcttccttaataatgctgccaccccc
atttcaaacgttgtctacaccagttcgacaaaggtggtgagcatccctgatctccaggga
ctgttactgggacaagaattctccattgagtggaatcttccagtgcatgacctgcagaag
ttcaactgctaccccgaggagcctgcggtctccgaggagaactgccagcagcgggggtgc
ctgtgggagcccacgacggtgcccggcgtgcccacctgtttctacgacaccatccctaat
tacgccgccagcaacattcagtacctgcccacgggcatcaccacagacctttcccacctg
acagcccctgaatcggcagcaccaccgtcttcacggggcgagcaaatccaacccccagtc
gccgccgccgccgccaaggctgcctcggcctccgatcccctctccgccaagatcagcttt
ctccgagtgagcgtcatctaccacaccgcaaccatgctgcagttcaagatctatgatccc
actaataaaaggtatgaggtcccagtatctctgaacacacctccctctccagttggctcc
actgcagaccggctgtatgatgtcaggattcagaacaatcctttcgggatccagattcga
cgaaaaagctctggcactgtgatttgggactcgcagctccctggtttcaccttcaacgac
ctgttcctttccatctccacgcgcctcccgtctcagtacctctatggctttggggagaca
gagcacacgacgttcagaagaaacatgagctggcacatgtggggaatgttcgcccgagat
gaaccccccgcgtacaagaagaattcctacggtgtccacccctactacatggcactggag
ggggatggcaatgcccacggagtcctcctgctgaacagcaacgccatggatgtgaccttc
cagccgactcctgccctgacataccgcaccacaggaggaattttggacttttatatggtt
ttggggccaacccccgagcttgtaactcagcaatacaccgagttgattggtcagccagca
atggttccatactgggccttgggattccagctgagtcgatatggataccagaatgatgct
gaaatttccaatttgtatgatgcaatggtggcagctcagattccctacgacgtccagcac
gttgacatcgattacatggaccggaagctggacttcaccctcagccccagctttcagaac
cttggcctcctgattgagcaaatgaagaaaaatggcatgagatttattctcatcctggat
ccagccatttctggcaatgagacccagtatctcacattcaccagagggcaggaaaacaac
gtattcatcaaatggccagacaacagtgatattgtctggggaaaggtttggccagacctg
cctaatgtgaatgtggatgggtcccttgaccctgacactcaggtgaagctgtacagagcc
catgtggcttttcctgacttcttgcggaacagcacggctgcctggtggaagaaggaaata
gaagaactctacagaaaccctcgcgagccagagaagagcttgaagtttgatggattgtgg
attgacatgaatgaaccatcaaactttgtggatggctctgtcacgggctgcagcgatgac
gtgctgaataatccaccctatatgccgcatttggagtccagggacgggggcctgagcaac
aagaccctgtgcatggagagccagcagatcctgcccgacggctcccccgtgcggcactac
gacgtccacagcctctacggctggtcccagaccagacccacctacgaagcggtgcaggag
gtgaccggacagcgaggagtcgtcatcactcgctccaccttcccctcttctggccgctgg
tcaggacactggctgggcgacaacacggcagcgtgggaccagctgaggaaatctatcatc
ggcatgatggagttcagtctctttggagtcccttatacaggagcagacatttgtgggttc
ttcggagatgctgagtatgagatgtgtgtccgctggatgcagctgggggcgttttatcca
ttttccaggaaccacaacacatttgggacaaggagacaagatcctgtggcctggaactca
acctttgagatgttctcaagaaaagtcctccagaccagatacgccctgctgccttacctc
tacacgctgatgcacaaagctcacgttgaaggcagcactgttgtccgaccccttctccat
gagtttaccaaggatgctacaacatgggacatagaccagcagttcatgttgggtcctgcc
gtcttgatcagccctgttctggaaagtaacacttttcagatccttgcttattttcccaga
gcccgttggtatgactatagcacggaatctggcagtgaatcgccaggtgagtggaaaatc
ctggcggctccccttgaccatatcaaccttcatatcagaggaggctacatcctgccctgg
caggaacctgcgatgaacaccttctccagtcgacagaaatttatgggattgattgttgct
ttggatagcagtgggagagctgacggtcaaatattctgggatgatggacaaagcatcgac
acctatgaaaacggaaactatttcttggcaaactttacagcagctcagaacgtattgcaa
attcagaccatacacaataagtatttgagtgactctaatccactgaaagttggctatatt
agaatctggggcataaactctacttatgtaacacaagtcactctcacctatgacaaccag
caatttgtggtgatgactttcaagagtgacccttataatcagacactaactattcaattg
actgacaagattatcagcctggaaaagttaactgagatttcttggattcatggtggtcct
atagtttcaactacgccaatgatgagtaccttcccaaagagttcttcatatcctcctaca
tttactactagagctaccccctctgagactattagtactagttctgctacaacaagcact
gctactgctagcagtattgttactcttcctgtcacaaccacacctttcttaacaaatgct
actcaagttccaactggtactactgttcctgataacgtgacatcttcccctacaaatgct
accagtgctggcattattgtcactcttcctgtcacaatcacatctttcccaacaggtact
cctgaagtgccacctggtacgactgatcttaataacataacatcttcccctaaaaatatt
accactgctagtactgatgttacccttcctttcacacccacacctttcccaacaggtact
cctgaagttccaactggtccttctattctaaacaccacaacatcttcccctacaaatact
accactcctagcacgaatgttactcctcctgttacaatcatgcctttcccaacaagtact
actgaaatctcaactggtactactgttcctgctaacacgacagcttcccctacaaatgct
actactgctagcgctgatgttactcttcctgtcacaaccacacctttcttaacaaatgct
actcaagttccaactggtactactgttcctgataacgtgacatcttcccctacaaatatt
accactgctagtactgatgttacccttcctttcacacccacacctttcccaacagctact
cctgaagttccaactggtccttctattctaaacaccacaacatcttcccctacaaatact
accactcctagcacgaatgttactcctcctgttacaatcatgcctttcccaacaagtact
actgaaatctcaactggtactactgttcctgctaacacgacagcttcccctacaaatgct
actactgctagcgctgatgttactcttcctgtcacaaccacacctttcttaacaaatgct
actcaagttccaactggtactactgttcctgataacgtgacatcttcccctacaaatact
accactgctggcactgttgttacccttcctgtcacaaccacacctttcttaacaaatgct
actcaagttccaactggtactactgttcctgataacgtgacatctccccacaaatctccc
t

DBGET integrated database retrieval system