KEGG   Sus scrofa (pig): 100623494Help
Entry
100623494         CDS       T01009                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351 isoform X1
  KO
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ssc  Sus scrofa (pig)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100623494 (MGAM2)
   00500 Starch and sucrose metabolism
    100623494 (MGAM2)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100623494 (MGAM2)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100623494 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100623494 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
18
AA seq 2506 aa AA seqDB search
MARKFSILEILLIIFVLIILAVDILLLLLVLENPSDASFIPECPEVPEAERIDCAPGQEV
TEDVCRWRYKCCWKPVANTDIPWCFFPRNWGYEVSSWVKNTSTVLSAQLRRLPSPSLFGN
DVIDTLFTAEYQTSNRFHFKVTDFNNIRYEVPHESVRLFDDGAADTSNSSYHVEIVNKPF
SVKIMRTSNQRVLLDTSIGPLQVAQQYLQLSFRLPSANVYGLGEHVHQQYRHSMAWRTWP
IFTRDATPTQGMINLYGAHPFFLCLEDTSGYSFGVFLMNSNAMEVTLQPAPAITYRTTGG
ILDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGIDGLKKVVNRNRAAE
IPYDVQYSDVDYMDGKKDFTVDGVAFYNLSGFVRELHSYGLKYVIMMHPGIVNNSDYPPY
VNGREKRVWILGNKGAVIGQGYPGWTVFPDFSNPACTEWWKDQFVEFNSTLEFDGVWIEM
DEVSSFLQSPDHECELNNLNFPPFTPRVVDRLLFARTLCMDAEFHEGLHYDVHSLYGYFM
ARATDRAMEAILSNKRGFILSRSTFAGSGTFAGHWLGDNAATWDDLRWSIPSILEFNLFG
IPMVGANICGYTENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNSTLLNSA
RHYLNIRYTLLPYLYTLFYRAHSLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPV
LYEGVDSAKAYIPDAIWYDYETGVATQWRKQFVEMLLPGDRIGLHLRGGYIFPTQQPNTT
TEASRRNSLGLIIALDYKREAKGQLYWDDGESKDAVAQNKYILYDFSVTSNRLQAKIIKN
TYTDPNGLTFTNITILGMDKEPANFTVFLNNAATPISNVVYTSSTKVVSIPDLQGLLLGQ
EFSIEWNLPVHDLQKFNCYPEEPAVSEENCQQRGCLWEPTTVPGVPTCFYDTIPNYAASN
IQYLPTGITTDLSHLTAPESAAPPSSRGEQIQPPVAAAAAKAASASDPLSAKISFLRVSV
IYHTATMLQFKIYDPTNKRYEVPVSLNTPPSPVGSTADRLYDVRIQNNPFGIQIRRKSSG
TVIWDSQLPGFTFNDLFLSISTRLPSQYLYGFGETEHTTFRRNMSWHMWGMFARDEPPAY
KKNSYGVHPYYMALEGDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTP
ELVTQQYTELIGQPAMVPYWALGFQLSRYGYQNDAEISNLYDAMVAAQIPYDVQHVDIDY
MDRKLDFTLSPSFQNLGLLIEQMKKNGMRFILILDPAISGNETQYLTFTRGQENNVFIKW
PDNSDIVWGKVWPDLPNVNVDGSLDPDTQVKLYRAHVAFPDFLRNSTAAWWKKEIEELYR
NPREPEKSLKFDGLWIDMNEPSNFVDGSVTGCSDDVLNNPPYMPHLESRDGGLSNKTLCM
ESQQILPDGSPVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWSGHWL
GDNTAAWDQLRKSIIGMMEFSLFGVPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNH
NTFGTRRQDPVAWNSTFEMFSRKVLQTRYALLPYLYTLMHKAHVEGSTVVRPLLHEFTKD
ATTWDIDQQFMLGPAVLISPVLESNTFQILAYFPRARWYDYSTESGSESPGEWKILAAPL
DHINLHIRGGYILPWQEPAMNTFSSRQKFMGLIVALDSSGRADGQIFWDDGQSIDTYENG
NYFLANFTAAQNVLQIQTIHNKYLSDSNPLKVGYIRIWGINSTYVTQVTLTYDNQQFVVM
TFKSDPYNQTLTIQLTDKIISLEKLTEISWIHGGPIVSTTPMMSTFPKSSSYPPTFTTRA
TPSETISTSSATTSTATASSIVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNATSAGI
IVTLPVTITSFPTGTPEVPPGTTDLNNITSSPTNITTASTDVTLPVTPTPFPTGTPEVPP
GTTDLNNITSSPKNITTASTDVTLPFTPTPFPTGTPEVPTGPSILNTTTSSPTNTTTPST
NVTPPVTIMPFPTSTTEISTGTTVPANTTASPTNATTASADVTLPVTTTPFLTNATQVPT
GTTVPDNVTSSPTNITTASTDVTLPFTPTPFPTATPEVPTGPSILNTTTSSPTNTTTPST
NVTPPVTIMPFPTSTTEISTGTTVPANTTASPTNATTASADVTLPVTTTPFLTNATQVPT
GTTVPDNVTSSPTNTTTAGTVVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNTTTAGT
VVTLPVTTTPFPTSTPEVPTGTSILNTTVSSPTNTTTPSTNVTPPVTIMPFPTSTTEISI
GTTVPDNTTASPTNATTASADVTLPVTTTPFLTNATQVPTGTTVPDNVTSSPTNATSAGI
IVTLPVTITSFPTGTPEVPPGTTDLNNITSSPTNITTASTDVTLPVTPTPFPADTSEVPT
GPSILNTTTSSPTNTTTPSTNVTLSVTIMLPTILLKFQLVRLILIT
NT seq 7521 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagtttagcatattggaaatccttctgatcatctttgtcctaattatattg
gccgtagatatcctcttgctgcttctcgtgttggaaaatccttcagatgcttcatttatt
ccggagtgtccagaagtccctgaagcagaaaggatagactgtgctcccggccaggaggtg
acagaggatgtctgcagatggagatataagtgctgctggaagcctgtcgcaaacactgat
atcccttggtgcttcttccccagaaactggggctatgaagtcagcagttgggttaaaaat
acaagcacagtgctttctgcccagttgagaaggttgccgtccccgtccctgtttggaaat
gacgtcatcgacaccctcttcacagctgagtaccagacatccaatcgttttcatttcaag
gtcactgatttcaataacatacgctatgaagtcccccatgaaagtgtcaggctgttcgac
gatggggctgctgatacctccaattcgagctatcacgtagaaatcgttaacaaacccttc
agcgtcaaaattatgaggacgagcaaccagagagtcttgctggacacaagcatcgggccc
ctccaggttgcccagcagtatctgcagctgtccttccggctacccagcgccaacgtgtac
gggctgggagaacacgtgcaccaacagtaccgccacagcatggcctggaggacctggccc
atcttcacccgggatgccacccccacccagggtatgattaatctgtatggagctcaccca
ttcttcctgtgccttgaagacaccagcggctactcttttggggtttttctgatgaacagt
aatgccatggaggtcaccctccagcccgctcctgctatcacttatcgtaccactgggggc
attctcgacttctacgtgttcctgggaaatactccagaacaggtggttcaggagtatctg
gagcttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgt
agggattatggtggcatcgacgggttgaaaaaagttgtaaaccgaaatcgtgcagctgag
atcccatatgatgtccagtactctgatgtagactacatggatggaaagaaggatttcact
gttgatggagtggctttctataatctctcaggttttgtcagagagttacatagctatgga
ttgaaatatgtaattatgatgcatcctggcatcgtaaataactctgactaccctccttat
gtgaatggaagagaaaagagagtgtggatcttggggaacaaaggtgctgtcattgggcag
gggtacccaggatggacagtctttcctgacttcagtaatccagcttgcactgaatggtgg
aaagaccagttcgttgaatttaacagtactctggagtttgatggagtgtggattgaaatg
gatgaagtatccagcttcctccaaagtcctgatcatgagtgtgaactgaacaacttgaac
tttcctcctttcactcctcgtgtcgtggaccgcttgctttttgcaagaaccctctgcatg
gacgctgagtttcacgagggccttcactatgatgtccacagcctgtatggctacttcatg
gcaagagccacagacagggcgatggaggccatcctctccaataaaagaggcttcatcctg
tcccgttctacttttgccggatctggcacatttgctggtcattggctgggggacaacgca
gccacatgggatgatctccgatggtccattcccagtatcctggaattcaacctatttggc
attcccatggtgggcgccaacatctgtggttatacagaaaatgtcacagaggaactctgc
agaaggtggatgcagcttggagcattttatccgctatcgaggaatcacaacgggcctggg
ttcagggaccaggatccggctgcctttagtgaaaacaactcaacgctgttgaattccgcc
agacactatttgaacatccgctacaccctgctgccctatctctacacccttttctaccga
gctcattccttgggggagaccgtagccaggcccctcgtccatgagttctaccaggaccca
gccacgtgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtt
ttatatgaaggtgtggactctgcaaaagcgtacataccggacgccatctggtacgactat
gagactggagtagccacccaatggaggaaacaatttgtggagatgctactgccaggtgac
aggataggacttcaccttcgagggggctacatctttcccacccagcagccaaacacaacc
acagaggccagtcggaggaattccctgggactcatcattgccttggactataagagagaa
gcaaaggggcagctgtactgggatgacggtgaatctaaagatgctgtagctcaaaacaaa
tacattctgtatgatttttctgtcacctctaaccgtctccaggcaaagattataaaaaat
acgtacacagaccccaacggactcacatttacaaatatcacaatcttgggaatggacaag
gaacctgctaattttactgtcttccttaataatgctgccacccccatttcaaacgttgtc
tacaccagttcgacaaaggtggtgagcatccctgatctccagggactgttactgggacaa
gaattctccattgagtggaatcttccagtgcatgacctgcagaagttcaactgctacccc
gaggagcctgcggtctccgaggagaactgccagcagcgggggtgcctgtgggagcccacg
acggtgcccggcgtgcccacctgtttctacgacaccatccctaattacgccgccagcaac
attcagtacctgcccacgggcatcaccacagacctttcccacctgacagcccctgaatcg
gcagcaccaccgtcttcacggggcgagcaaatccaacccccagtcgccgccgccgccgcc
aaggctgcctcggcctccgatcccctctccgccaagatcagctttctccgagtgagcgtc
atctaccacaccgcaaccatgctgcagttcaagatctatgatcccactaataaaaggtat
gaggtcccagtatctctgaacacacctccctctccagttggctccactgcagaccggctg
tatgatgtcaggattcagaacaatcctttcgggatccagattcgacgaaaaagctctggc
actgtgatttgggactcgcagctccctggtttcaccttcaacgacctgttcctttccatc
tccacgcgcctcccgtctcagtacctctatggctttggggagacagagcacacgacgttc
agaagaaacatgagctggcacatgtggggaatgttcgcccgagatgaaccccccgcgtac
aagaagaattcctacggtgtccacccctactacatggcactggagggggatggcaatgcc
cacggagtcctcctgctgaacagcaacgccatggatgtgaccttccagccgactcctgcc
ctgacataccgcaccacaggaggaattttggacttttatatggttttggggccaaccccc
gagcttgtaactcagcaatacaccgagttgattggtcagccagcaatggttccatactgg
gccttgggattccagctgagtcgatatggataccagaatgatgctgaaatttccaatttg
tatgatgcaatggtggcagctcagattccctacgacgtccagcacgttgacatcgattac
atggaccggaagctggacttcaccctcagccccagctttcagaaccttggcctcctgatt
gagcaaatgaagaaaaatggcatgagatttattctcatcctggatccagccatttctggc
aatgagacccagtatctcacattcaccagagggcaggaaaacaacgtattcatcaaatgg
ccagacaacagtgatattgtctggggaaaggtttggccagacctgcctaatgtgaatgtg
gatgggtcccttgaccctgacactcaggtgaagctgtacagagcccatgtggcttttcct
gacttcttgcggaacagcacggctgcctggtggaagaaggaaatagaagaactctacaga
aaccctcgcgagccagagaagagcttgaagtttgatggattgtggattgacatgaatgaa
ccatcaaactttgtggatggctctgtcacgggctgcagcgatgacgtgctgaataatcca
ccctatatgccgcatttggagtccagggacgggggcctgagcaacaagaccctgtgcatg
gagagccagcagatcctgcccgacggctcccccgtgcggcactacgacgtccacagcctc
tacggctggtcccagaccagacccacctacgaagcggtgcaggaggtgaccggacagcga
ggagtcgtcatcactcgctccaccttcccctcttctggccgctggtcaggacactggctg
ggcgacaacacggcagcgtgggaccagctgaggaaatctatcatcggcatgatggagttc
agtctctttggagtcccttatacaggagcagacatttgtgggttcttcggagatgctgag
tatgagatgtgtgtccgctggatgcagctgggggcgttttatccattttccaggaaccac
aacacatttgggacaaggagacaagatcctgtggcctggaactcaacctttgagatgttc
tcaagaaaagtcctccagaccagatacgccctgctgccttacctctacacgctgatgcac
aaagctcacgttgaaggcagcactgttgtccgaccccttctccatgagtttaccaaggat
gctacaacatgggacatagaccagcagttcatgttgggtcctgccgtcttgatcagccct
gttctggaaagtaacacttttcagatccttgcttattttcccagagcccgttggtatgac
tatagcacggaatctggcagtgaatcgccaggtgagtggaaaatcctggcggctcccctt
gaccatatcaaccttcatatcagaggaggctacatcctgccctggcaggaacctgcgatg
aacaccttctccagtcgacagaaatttatgggattgattgttgctttggatagcagtggg
agagctgacggtcaaatattctgggatgatggacaaagcatcgacacctatgaaaacgga
aactatttcttggcaaactttacagcagctcagaacgtattgcaaattcagaccatacac
aataagtatttgagtgactctaatccactgaaagttggctatattagaatctggggcata
aactctacttatgtaacacaagtcactctcacctatgacaaccagcaatttgtggtgatg
actttcaagagtgacccttataatcagacactaactattcaattgactgacaagattatc
agcctggaaaagttaactgagatttcttggattcatggtggtcctatagtttcaactacg
ccaatgatgagtaccttcccaaagagttcttcatatcctcctacatttactactagagct
accccctctgagactattagtactagttctgctacaacaagcactgctactgctagcagt
attgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatgctaccagtgctggcatt
attgtcactcttcctgtcacaatcacatctttcccaacaggtactcctgaagtgccacct
ggtacgactgatcttaataacataacatcttcccctacaaatattaccactgctagtact
gatgttacccttcctgtcacacccacgcctttcccaacaggtactcctgaagtgccacct
ggtacgactgatcttaataacataacatcttcccctaaaaatattaccactgctagtact
gatgttacccttcctttcacacccacacctttcccaacaggtactcctgaagttccaact
ggtccttctattctaaacaccacaacatcttcccctacaaatactaccactcctagcacg
aatgttactcctcctgttacaatcatgcctttcccaacaagtactactgaaatctcaact
ggtactactgttcctgctaacacgacagcttcccctacaaatgctactactgctagcgct
gatgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatattaccactgctagtact
gatgttacccttcctttcacacccacacctttcccaacagctactcctgaagttccaact
ggtccttctattctaaacaccacaacatcttcccctacaaatactaccactcctagcacg
aatgttactcctcctgttacaatcatgcctttcccaacaagtactactgaaatctcaact
ggtactactgttcctgctaacacgacagcttcccctacaaatgctactactgctagcgct
gatgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatactaccactgctggcact
gttgttacccttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatactaccactgctggcact
gttgttacccttcctgtcacaaccacacctttcccaacaagtactcctgaagttccaact
ggtacttctattctaaacaccacagtatcttcccctacaaatactaccactcctagcaca
aatgttactcctcctgttacaatcatgcctttcccaacaagtactactgaaatttcaatt
ggtactactgttcctgataacacgacagcttcccctacaaatgctactactgctagcgct
gatgttactcttcctgtcacaaccacacctttcttaacaaatgctactcaagttccaact
ggtactactgttcctgataacgtgacatcttcccctacaaatgctaccagtgctggcatt
attgtcactcttcctgtcacaatcacatctttcccaacaggtactcctgaagtgccacct
ggtacgactgatcttaataacataacatcttcccctacaaatattaccactgctagtact
gatgttacccttcctgtcacacccacacctttcccagcagatacttctgaagtgccaact
ggtccttctattctaaacaccacaacatcttcccctacaaatactaccactcctagcacg
aatgttactctttctgtcacaataatgcttccaacaatactactgaaatttcaactggta
cgactaatcttaataacataa

DBGET integrated database retrieval system