KEGG   Sus scrofa (pig): 100623735Help
Entry
100623735         CDS       T01009                                 

Gene name
USP16
Definition
ubiquitin specific peptidase 16
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100623735 (USP16)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100623735 (USP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 823 aa AA seqDB search
MGKKRTKGKTVPIDDSSESLEPTCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
SEEETENPSVWLCLKCGHQGCGRDSQEQHALKHYMTPRSEPHCLVLSLDNWSVWCYLCDD
EVQYCNSNRLGQVVDYVRKQAGITAPKSAAKDNGNIELENKKLEKESKNEQEREKKENKA
KENPSMNSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGIVTPRELFSQVCKKAVRFKGYQQQDSQ
ELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSVPSFVDRIFGG
ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNLKKTMEDEDKDCEEEKDN
DSYIKERNDIPSGTSKHLQKKAKKQAKKQAKYQRRQQKIQGKVLHLNDVCAVDHPEDNEC
EVEASTSEVDVKSSHTSQEEVMHKECCEKDLNGHEKTVESVTDNQKSTEEGDMKIVNLDN
DLEVLASSPTECTGNLNGAYLKAGSNGEVDISSGFKNLNLNAALEPDEINIEILNDDLTP
GAKVYEVVNEDPETAFCTLANREAFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRRQ
YSGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEILD
LAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSDLVLHGDI
PQDFEMESTKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaattgatgattcttctgaatcttta
gaacccacatgcagacacattagaaaaggactggaacaaggtaatttgaaaaaggctttg
gtgaatgtggaatggaacatttgccaagattgtaagacggacaataaagtaaaagataaa
tctgaagaagaaacagaaaatccttcggtttggctttgtcttaaatgtggccatcagggc
tgtggcagagattctcaggagcagcatgccttgaagcactacatgacgccaagatctgaa
cctcattgcctggttcttagtttggacaactggagtgtatggtgttacctatgtgatgat
gaggtccagtattgtaattcaaaccgattgggtcaggtggttgactatgttagaaaacaa
gctggtattacagctccaaaatcagcagccaaagataatggtaatattgaacttgaaaat
aaaaaactggaaaaagaaagtaaaaatgagcaagagagagaaaaaaaagaaaacaaggct
aaagaaaatccttccatgaattctgcttcccaaataactgtgaaaggactcagtaacttg
ggaaatacatgtttcttcaatgcagttatgcagaatttgtcacagaccccagtgcttaga
gaattactaaaagaagtaaaaatgtctggaacaattgtaaaaattgaaccacctgatttg
gccctaacagaacccttagaaataaaccttgagcctccaggccctcttactttagccatg
agccagtttcttaatgagatgcaagagaccaaaaagggaatcgtgacacctagagaactc
ttttctcaggtctgtaaaaaagcagtgcgttttaaaggctatcagcagcaagacagccag
gagctgcttcgatatttattggatggaatgagagcagaagaacatcaaagagtgagtaaa
ggaattcttaaagcatttggtaattctactgaaaaactggatgaagaactaaaaaataaa
gttaaagattatgaaaagaaaaaatctgtaccaagttttgtggaccgaatatttggtggt
gaactaactagtacaatcatgtgtgacgaatgcagaactgtatccttggttcatgaatct
ttccttgatttgtctctaccagttttagatgatcagagtggtaagaaaagtataaatgat
aaaaatctgaaaaagacaatggaggatgaagataaagactgtgaggaagaaaaagataat
gacagttacataaaggagagaaatgatattccttcaggaacaagtaagcacttacagaaa
aaagcaaagaagcaagccaaaaagcaagccaagtaccaacgaaggcaacaaaaaattcaa
ggaaaagttcttcatttaaatgatgtctgtgccgttgaccatcctgaagataatgaatgt
gaagttgaagcgtccacttcagaagtggatgttaaatccagccatacctcacaagaggaa
gttatgcataaggaatgttgtgagaaagatttgaatggccatgaaaaaacagtagaaagt
gtgactgacaatcaaaaatccacagaggaaggagatatgaaaattgtcaacctggacaat
gatctagaggttttagcctcttctcccacggaatgtactgggaatttgaatggtgcctac
ctgaaggcagggagcaacggggaagtggacatttccagtggttttaagaaccttaacttg
aatgctgctcttgaacctgacgagataaatatagagattctgaatgatgatcttactcct
ggggcgaaggtatatgaggttgtaaatgaagatccagaaactgctttctgtactcttgca
aacagggaagctttcaatacggatgagtgttcaatccaacattgtttatatcagttcact
cgaaatgagaaacttcgagatgctaataaactgctttgtgaagtgtgcacgcggagacag
tatagtggaccaaaggcaaatataaaaggtgaaaggaaacatgtttacaccaatgctaag
aagcagatgctaatttctcttgctcctcctgttctcactcttcatttaaagagatttcag
caggctggttttaacctacgcaaagttaacaaacacataaaatttccagaaatcttagat
ttggctcctttttgtacccttaagtgtaagaatgttgctgaagaaaatacaagggtactg
tactccttatatggagtcgttgaacacagtggtaccatgcggtcagggcattatactgcc
tatgccaaggcaagaactgcaaacagccatctctctgatcttgttctccacggtgatatt
ccacaagattttgaaatggagtcaaccaaagggcagtggtttcacatcagcgacacacat
gtgcaagctgtgcctacaactaaagtactaaactcacaggcttacctcctattttatgag
agaatactgtaa

DBGET integrated database retrieval system