KEGG   Sus scrofa (pig): 100624053Help
Entry
100624053         CDS       T01009                                 

Gene name
OTUD5
Definition
OTU domain containing 5
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100624053 (OTUD5)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100624053 (OTUD5)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100624053 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 566 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGPR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGTVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGXCLLRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALA
KPPSPCAPGTSSQFSTGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASV
LAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccgcctcccgacgccgacccagccaacgagccg
ccgccgcccgggccgctgcccccggcgccgcggcgcggcgggggtgtaggcgtgggcggc
ggtggcacgggcgtgggtggtggcgaccgcgaccgtgactcgggcgtcgtggggccccgt
ccccgagcttcgccaccgcctcagggcccgctcccggggccaccaggtgcactccaccgc
tgggcgctggccgtgccgcccggcgccgtggcgggaccccggccacagcaggcctctcct
cctccttgcgggggtcccggcggtcccggcggcggtcctggtgacgcgttgggtgcagcg
gcagcgggggtgggcgcggcgggcgtggtggtgggtgtgggcggcaccgtgggcgtgggc
ggctgctgctccgggccgggccacagcaagaggcggcgtcaagcccccggggttggcgcg
gtcggcgggggcagccctgagcgcgaggaggtcggcgcaggttacaacagtgaggacgag
tatgaagcggctgcagcgcgcatcgaggccatggaccccgccaccgttgagcagcaggag
cactggttcgaaaaggccctgcgagacaagaagggcttcatcatcaagcagatgaaggag
gacggcngctgtctcctccgggctgtagctgaccaagtgtatggagaccaggacatgcat
gaggttgtgcgaaagcactgcatggactatctgatgaagaatgccgactatttctccaac
tatgtcacagaagacttcaccacctacatcaaccggaagcggaaaaacaactgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccggcccgtggaggtgtatcag
tacagcacagaacccatcaacacattccatgggatccatcaaaatgaggatgaacccatc
cgtgtcagctaccatcggaatatccactacaattcagtggtgaatcctaacaaggccacc
attggtgtggggctgggcctgccatcattcaaaccggggtttgcagagcagtccctgatg
aagaatgccataaagacgtcggaggagtcctggattgaacagcagatgctggaagacaag
aagcgggccacagactgggaggccacaaacgaggccattgaggagcaggtggctcgggag
tcctacctgcagtggctacgggatcaagagaaacaggcccgccaagtccgtggccccagc
cagccccggaaagccagcgccacatgcagttctgccacagcagcagcctccagtggtctg
gaggagtggaccagccggtccccgcggcagcggagttcagcctcgtcacccgagcaccct
gagctacatgctgagctgggcatcaagcccccttccccaggcactgtcttagctcttgcc
aaacctccttcgccctgtgcaccaggtacaagcagccagttctcgacaggggccgaccgg
gctacttcccccctcgtgtccctctaccctgctctggaatgccgggccctcattcagcag
atgtccccctctgcctttggtctgaacgactgggatgatgatgagatcctagcatcggtg
ctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagac
ccacccccagacaagagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system