KEGG   Sus scrofa (pig): 100624429Help
Entry
100624429         CDS       T01009                                 

Gene name
USP38
Definition
ubiquitin specific peptidase 38
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 499 aa AA seqDB search
MDKILEGLVSSSHPLPLKRVIVRKVVESAENWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLQQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVHRMVCERPEPHLCARLSDLLSDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQEKELREYVSQVTKVSNLLQNIWKGEPSTLLPSLQEVFASISSTDASFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHVVNLVH
SFRSDGLPSSTAFLVQLTELIHCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRVSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggagggcctggtgagctcttcgcaccccctgcccctaaaacgggtg
attgtgaggaaggtggtggagtcggcggagaattggctggacgaggcgcagtgcgaggcc
atgtttgacctgacgacccggcttatcttggagggccaggacccctttcagcggcaagtg
ggccaccaagtgctggaggcctacgcgcggtaccaccggccagaattcgagtccttcttc
aataagactttcgtgctgggcctccttcagcagggctaccactcgctggacaggaaggac
gtagccatcctggactacattcacaacggcttgaaactgatcatgagctgcccctcggtg
ctggacctcttcagcctgctgcaggtggaggtgcatcggatggtgtgtgagaggcccgag
ccgcacctgtgcgcccgactcagcgacctcctgagcgacttcgtgcagtgcatccccaag
gggaagttgtccatcactttttgtcaacagctggttcgaacgataggccacttccagtgc
gtgtccacccaggagaaagagctgcgggaatatgtctcgcaggtgacaaaagtgagtaac
ttgctgcagaatatctggaagggggagccctccaccctgctgccttccctgcaagaagtt
tttgcaagcatttcttccacagatgcatcatttgaaccatctgtagcgttggcaagcctt
gtgcagcacattcctcttcagatgattacagttctcatcaggagccttaccacggatcca
aatgtaaaagatgcaagtatgacccaagctctttgcagaatgattgactggctgtcctgg
ccattggctcagcatgtagacacatgggtgattgcactcttgaaaggactggcagctgtc
cagaagtttactattttgatagatgttactttactgaaaatagagctggtttttaatcgc
ctttggtttcctcttgtgagacccggtgctcttgcagttctttctcacatgctacttagt
tttcagcattctccagaggcgtttcatttgattgttcctcatgtagttaatttggttcac
tccttcagaagtgatggtctgccttccagtacagccttcctagtgcagttaacagaactg
atacactgtatgatgtatcattattctggatttccagatctctatgaacctatcctggaa
gcaataaaggattttcctaagcccagtgaagagaagattaaattgattctcaatcaaagt
gcctggacttctcaatccaattctttggcatcttgcttgtctagagtttctggaaaatct
gaaactgggaaaactggtcttattaacctagggaatacatgttatatgaacagtgttata
caagcattgtttatggccacagatttcaggagacaagtcttatctttaaatctaaatggg
tgcaattcattaatgaaaaaattacagcatctttttgcctttttggctcatacacag

DBGET integrated database retrieval system