KEGG   Sus scrofa (pig): 100624570Help
Entry
100624570         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase CYLD-like
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:ssc04622]
Organismal Systems; Development; Osteoclast differentiation [PATH:ssc04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 378 aa AA seqDB search
MEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQE
LLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEP
LLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPR
FGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYEDPDISAGKIKQFCK
TCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKY
GKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRL
LCDAYMCMYQSPTMSLYK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggaaggtttagagataatgattggaaagaagaaaggtatccagggtcattac
aattcttgttacttagactcaaccttattctgcttatttgcttttagttccgttctggac
actgtgttacttagacccaaagaaaagaatgatgtagaatattatagtgaaactcaagag
ctactgaggacagaaattgttaatcctctgagaatatacggatatgtatgtgcaacaaag
attatgaaactgaggaaaatacttgaaaaagttgaggctgcatcaggatttacctctgaa
gaaaaagatcctgaagaatttttgaatatcctgtttcatcatattttaagggtagaacca
ttgttaaaaataagatcagcaggtcaaaaagtacaagattgttacttctatcaaattttt
atggaaaaaaatgagaaagttggagttcctacaattcagcagttgttagaatggtctttt
atcaacagtaacctgaaatttgcggaggcaccatcatgtctgattattcagatgcctcga
tttggaaaagactttaaactatttaaaaaaatttttccatctctggaattaaatataaca
gatttacttgaagacaccccgcggcagtgccggatatgtggcgggctcgccatgtacgag
tgcagagagtgctacgaggaccccgacatctcagctgggaaaatcaagcagttctgtaaa
acctgcaacactcaagtccaccttcaccccaagaggttgaatcataaatataaccccgtc
tcacttcccaaagatttacctgactgggactggagacacggctgcatcccctgccagaag
atggagttattcgctgttctctgcatagaaacgagccactatgtcgccttcgtgaagtac
gggaaggacgactccgcctggctcttctttgacagcatggctgatcgggatggtggtcag
aatggcttcaacattcctcaggtgaccccatgcccagaagtaggagagtacttgaaaatg
tctctagaagatctgcattccttggactcgagaagaatccagggctgtgcacgaagactt
ctctgtgatgcgtacatgtgcatgtaccagagtccaacaatgagtctgtacaagtaa

DBGET integrated database retrieval system