KEGG   Sus scrofa (pig): 100624570Help
Entry
100624570         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase CYLD-like
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100624570
  Development
   04380 Osteoclast differentiation
    100624570
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100624570
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C67
   100624570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 378 aa AA seqDB search
MEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQE
LLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEP
LLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPR
FGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYEDPDISAGKIKQFCK
TCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKY
GKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRL
LCDAYMCMYQSPTMSLYK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggaaggtttagagataatgattggaaagaagaaaggtatccagggtcattac
aattcttgttacttagactcaaccttattctgcttatttgcttttagttccgttctggac
actgtgttacttagacccaaagaaaagaatgatgtagaatattatagtgaaactcaagag
ctactgaggacagaaattgttaatcctctgagaatatacggatatgtatgtgcaacaaag
attatgaaactgaggaaaatacttgaaaaagttgaggctgcatcaggatttacctctgaa
gaaaaagatcctgaagaatttttgaatatcctgtttcatcatattttaagggtagaacca
ttgttaaaaataagatcagcaggtcaaaaagtacaagattgttacttctatcaaattttt
atggaaaaaaatgagaaagttggagttcctacaattcagcagttgttagaatggtctttt
atcaacagtaacctgaaatttgcggaggcaccatcatgtctgattattcagatgcctcga
tttggaaaagactttaaactatttaaaaaaatttttccatctctggaattaaatataaca
gatttacttgaagacaccccgcggcagtgccggatatgtggcgggctcgccatgtacgag
tgcagagagtgctacgaggaccccgacatctcagctgggaaaatcaagcagttctgtaaa
acctgcaacactcaagtccaccttcaccccaagaggttgaatcataaatataaccccgtc
tcacttcccaaagatttacctgactgggactggagacacggctgcatcccctgccagaag
atggagttattcgctgttctctgcatagaaacgagccactatgtcgccttcgtgaagtac
gggaaggacgactccgcctggctcttctttgacagcatggctgatcgggatggtggtcag
aatggcttcaacattcctcaggtgaccccatgcccagaagtaggagagtacttgaaaatg
tctctagaagatctgcattccttggactcgagaagaatccagggctgtgcacgaagactt
ctctgtgatgcgtacatgtgcatgtaccagagtccaacaatgagtctgtacaagtaa

DBGET integrated database retrieval system