KEGG   Sus scrofa (pig): 100624788Help
Entry
100624788         CDS       T01009                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A1 isoform X2
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ssc  Sus scrofa (pig)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100624788
   00053 Ascorbate and aldarate metabolism
    100624788
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100624788
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100624788
   00860 Porphyrin and chlorophyll metabolism
    100624788
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100624788
   00982 Drug metabolism - cytochrome P450
    100624788
   00983 Drug metabolism - other enzymes
    100624788
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100624788
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100624788
Glycosyltransferases [BR:ssc01003]
 Others
  Hydrophobic molecule
   100624788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
8
AA seq 528 aa AA seqDB search
MLNKNILLWSLQICLLGTTLGGNVLIWPMEGSHWLNIKIIIDELIKKEHNVTVLVASGAL
FITPTSNPSLKFEIYQVPFGKERIEGVIKNFVLTWMENRPSPLTIWRFYQEMAKVIKDFH
MMSREICDGVLKNQKLMEKLKRNKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTV
EKHCGKVPYPPSYVPAILSELTDQMSFTDRIRNFISYHLQDYMFNTLWKSWDSYYSKELG
RPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGE
DGIVVFTLGSMVKNLTEARADLIASALAQIPQKVLWRYSGKRPTTLGANTRLYDWIPQND
LLGHPKAKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNINTMT
SEDLLNALKTVINEPSYKENAMRLSRIHHDQPVKPLDRAIFWIEFVMRHKGAKHLRPAAH
DLTWYQYHSLDVIGFLLACVATVIFLVTMCCLFSYRKFGKTGKKKKRE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaagaacattctattgtggtctcttcagatatgcctcctaggaaccactctt
ggtgggaatgttctgatctggccaatggaagggagtcactggctaaatattaagataatt
atagatgaactgattaaaaaagagcataatgtgactgtcctagttgcttctggtgcactt
ttcatcacgccgacctctaacccatctctcaagttcgaaatatatcaggtgccctttggc
aaagaaagaatagaaggagtgatcaagaactttgttttgacatggatggaaaatagacca
tctcctttaaccatttggagattctatcaagagatggccaaagttatcaaggacttccac
atgatgtctagagaaatctgtgatggtgttcttaaaaaccaaaagctaatggaaaagctg
aagagaaacaaatttgaggtcttgctgtcagatccagtatttccttgtggtgatatagta
gctttgaaactgggaattccatttatctactctttgaggttttctccagcttcaacagtg
gaaaagcactgtgggaaggtaccataccctccttcctatgttcctgctattttatcagaa
ctcaccgaccagatgtctttcactgacagaataagaaatttcatttcctaccatctacag
gactacatgtttaatactctttggaaatcatgggattcttactacagtaaagaattggga
agacccacgaccttatgtgagactatggggaaagcagaaatttggctaatcaggacatat
tgggattttgaatttcctcgtccatacttgcctaattttgagtttgtaggaggattgcac
tgcaaaccggccaaaccattacctaaggaaatggaagaatttgtccaaagttcaggtgaa
gatggtatcgttgtatttactctggggtcgatggtcaaaaacctcacagaagcgagagcc
gatctcattgcctcagcccttgcccagattccacagaaggttttatggaggtactcagga
aagagaccgaccacactgggggccaatactcggctctatgactggattccacagaatgat
cttctcggtcaccccaaagcaaaagcttttatcactcatggtggaaccaatgggatctac
gaagctatttatcatggggtgccgatggtgggagtgcccatgttcgctgatcagcctgac
aacatcgctcacatgaaggccaagggggctgctgtggaggtgaacataaacacaatgaca
agcgaagatttgctcaatgccttgaagacagtcatcaatgaaccttcttacaaagagaat
gctatgaggttatccaggattcaccatgatcagcctgtaaagcccctggaccgagcaatc
ttctggatcgagtttgtcatgcgtcacaaaggagccaagcacctgcggccagcagcccac
gacctcacttggtaccagtaccactctctggatgtgattggattcctgctggcctgtgtg
gcaactgttatattcttggttacaatgtgttgtttgttttcttatcgaaaatttggtaaa
acaggaaagaagaaaaaaagggaatag

DBGET integrated database retrieval system