KEGG   Sus scrofa (pig): 100625117Help
Entry
100625117         CDS       T01009                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04114  Oocyte meiosis
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04380  Osteoclast differentiation
ssc04625  C-type lectin receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04720  Long-term potentiation
ssc04724  Glutamatergic synapse
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04924  Renin secretion
ssc05010  Alzheimer's disease
ssc05014  Amyotrophic lateral sclerosis (ALS)
ssc05031  Amphetamine addiction
ssc05152  Tuberculosis
ssc05166  HTLV-I infection
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100625117 (PPP3R2)
   04310 Wnt signaling pathway
    100625117 (PPP3R2)
   04370 VEGF signaling pathway
    100625117 (PPP3R2)
   04020 Calcium signaling pathway
    100625117 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    100625117 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100625117 (PPP3R2)
   04218 Cellular senescence
    100625117 (PPP3R2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100625117 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100625117 (PPP3R2)
   04660 T cell receptor signaling pathway
    100625117 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100625117 (PPP3R2)
   04659 Th17 cell differentiation
    100625117 (PPP3R2)
   04662 B cell receptor signaling pathway
    100625117 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    100625117 (PPP3R2)
   04921 Oxytocin signaling pathway
    100625117 (PPP3R2)
   04924 Renin secretion
    100625117 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    100625117 (PPP3R2)
   04720 Long-term potentiation
    100625117 (PPP3R2)
  Development
   04360 Axon guidance
    100625117 (PPP3R2)
   04380 Osteoclast differentiation
    100625117 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100625117 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    100625117 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    100625117 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    100625117 (PPP3R2)
   05166 HTLV-I infection
    100625117 (PPP3R2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100625117 (PPP3R2)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100625117 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100625117
NCBI-ProteinID: XP_003360852
Ensembl: ENSSSCG00000028206
Position
1
AA seq 170 aa AA seqDB search
MGNEPSNPMEMCSQFDQNEIKQLSKRFKKVDLDSSGTLTMKELMSLPGLQVNPLVQRVFD
IFDTDGNGEVDFKEFLVGTSQFSVKGDKEQKLRFAFSIYDMDKDGYISNGELFQVLNMMV
GDNLKDWQLQQLVDKTIIALDKDGDGKISFHEFCAVARNLKVHEKLGVIV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgagcccagtaacccaatggagatgtgctcccagtttgaccaaaacgaaatt
aaacagctgagcaagcggtttaagaaggtggacttggacagttcgggcactctgactatg
aaggagctcatgtccctgccggggctgcaggtgaacccgttggtgcagcgagtgttcgac
attttcgacacagacggcaacggagaagtggacttcaaggaattcctcgtggggacctcc
cagttcagtgtcaagggcgacaaggagcagaagctgaggtttgctttcagcatctatgac
atggacaaagacggctacatttccaacggggagctcttccaggtgctaaacatgatggtg
ggagacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcgccctg
gacaaggatggagatgggaaaatatccttccacgaattctgcgctgtggccagaaacctg
aaggtccacgagaaattgggggtaattgtgtga

DBGET integrated database retrieval system