KEGG   Sus scrofa (pig): 100625146Help
Entry
100625146         CDS       T01009                                 

Gene name
GAMT
Definition
guanidinoacetate N-methyltransferase
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100625146 (GAMT)
   00330 Arginine and proline metabolism
    100625146 (GAMT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100625146 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 236 aa AA seqDB search
MSAPSATPIFAPGENCSPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAVAASK
GGRVLEVGFGMAIAATKVQEGAIDEHWIIECNDGVFQRLQDWAQQQPHKVVPLKGLWEEV
APTLPDSHFDGILYDTYPLSEETWHTHQFNFIREHAFRLLKPGGVLTYCNLTSWGELMKS
KYSDITTMFQETQVPALLEAGFRQENIRTQVMELVPPADCRYYAFPQMITPLVTKQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccttccgcgacccccatcttcgcgccgggcgagaactgcagccccgcatgg
cgagctgcgcccgcggcctacgacgcgtcggacacgcacctgcagatcctgggcaagccg
gtgatggagcgctgggagaccccctacatgcacgcgctggcggccgtcgctgcctccaaa
gggggccgggtcctggaggtggggtttggcatggccatcgcagccactaaggtgcaggag
ggtgccatcgacgagcactggatcatcgagtgcaatgacggcgtcttccagcggctccag
gactgggcccagcagcagccacacaaggtggttcccttgaaaggcctgtgggaggaggtg
gcgcccaccctgccagacagtcacttcgatggaatcctgtatgacacgtacccgctgtct
gaggagacctggcacacacaccagttcaacttcatcagggaacatgctttccgcctgctg
aagccagggggcgtcctcacctactgcaacctcacctcctggggcgagctgatgaagtcc
aagtactcggacatcaccaccatgttccaggagacgcaggtgccagccctgctggaggca
ggtttcaggcaggagaacatccgcacacaggtcatggagctggtcccaccggccgactgc
cgctattatgccttcccgcagatgattacaccgctggtcactaagcagtga

DBGET integrated database retrieval system