KEGG   Sus scrofa (pig): 100625146Help
Entry
100625146         CDS       T01009                                 

Gene name
GAMT
Definition
(RefSeq) guanidinoacetate N-methyltransferase isoform X9
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00260  Glycine, serine and threonine metabolism
ssc00330  Arginine and proline metabolism
ssc01100  Metabolic pathways
Module
ssc_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100625146 (GAMT)
   00330 Arginine and proline metabolism
    100625146 (GAMT)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100625146 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 100625146
NCBI-ProteinID: XP_003354023
Ensembl: ENSSSCG00000023142
UniProt: A0A286ZU36
Position
2
AA seq 236 aa AA seqDB search
MSAPSATPIFAPGENCSPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAVAASK
GGRVLEVGFGMAIAATKVQEGAIDEHWIIECNDGVFQRLQDWAQQQPHKVVPLKGLWEEV
APTLPDSHFDGILYDTYPLSEETWHTHQFNFIREHAFRLLKPGGVLTYCNLTSWGELMKS
KYSDITTMFQETQVPALLEAGFRQENIRTQVMELVPPADCRYYAFPQMITPLVTKQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccttccgcgacccccatcttcgcgccgggcgagaactgcagccccgcatgg
cgagctgcgcccgcggcctacgacgcgtcggacacgcacctgcagatcctgggcaagccg
gtgatggagcgctgggagaccccctacatgcacgcgctggcggccgtcgctgcctccaaa
gggggccgggtcctggaggtggggtttggcatggccatcgcagccactaaggtgcaggag
ggtgccatcgacgagcactggatcatcgagtgcaatgacggcgtcttccagcggctccag
gactgggcccagcagcagccacacaaggtggttcccttgaaaggcctgtgggaggaggtg
gcgcccaccctgccagacagtcacttcgatggaatcctgtatgacacgtacccgctgtct
gaggagacctggcacacacaccagttcaacttcatcagggaacatgctttccgcctgctg
aagccagggggcgtcctcacctactgcaacctcacctcctggggcgagctgatgaagtcc
aagtactcggacatcaccaccatgttccaggagacgcaggtgccagccctgctggaggca
ggtttcaggcaggagaacatccgcacacaggtcatggagctggtcccaccggccgactgc
cgctattatgccttcccgcagatgattacaccgctggtcactaagcagtga

DBGET integrated database retrieval system