KEGG   Sus scrofa (pig): 100625207Help
Entry
100625207         CDS       T01009                                 

Definition
probable ubiquitin carboxyl-terminal hydrolase FAF-X-like
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100625207
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100625207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Y
AA seq 2552 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGHSQPLFQNQTSSPDSSNENSPATPPDEQGQGDAPPQHE
DEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVQSEACQRFFR
DGLTISFTKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNPH
CKFHIYNGTRPCESISSSAQLSEDELFARSSDPRSPKGWLVDLINKFGTLNGFQILHDRF
INGSALNVQIIAALIKPFGQCYEFLSQHTVKKYFIPIIEIIPQFLENLTDEELKKEAKNE
TKNDALSMIIKSLKNLASRIPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEINKV
ISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNKILSIVLRDSLHQPQYVEKLEKILRFVI
KEKALTLEDLDNIWAAQSGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNASK
KQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSCS
QDRDTQKIQWIDRFIEELRNNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHD
LINQLQHNHALVTLVAENLAAYMNNMRLYARDHEGYDPQTVRLGSRYSHVQEVQERLNFL
RFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFE
SNVLQLDPFLLTENGMKCFERFFKAVNCREGKLVAKRRTYMMDDLELIGLDYLWRVVMQS
NDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCILDGDKDSTN
CARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSLIVRFPNHGRQVDD
LDIWSHTNDTVGSVRRCILNRIKANVAHTKIELFVGGELIDSEDDRKLIGQLNLKDKSVI
TAKLTQVSSNMPSSPDSSSDSSTGSPGNICHRYSDGPNPEVERCLPGVIMSQHPRYISFL
WQVADLGSNLNMPPLRDGARILMKLMPIDSTTVEKLRAICLDQAKLGENNLGQSIDSLFF
GPSASQVLYLTEVVYALLMPAGTPLADDSSDFQYHFLKSGGLRLVYSMLTRNNFLPNTDT
ETRRGAYLSGLKIAKLLLTAIGYGHVRAVAEACHPVVDGADPVTPINQVTHDQAVVLQNA
LQSIPNPSSECMLRNISIRLAQQISDEASRYMPDICVLRAIQKIIWASGCGALELIFSPN
EEITKIYEMSINASKGPDMEDEQVCCEALEVMTLCFALIPTALDALSKEKSWQTFVINLL
LHCPSKTVRQLAQEQFFLMCTRCCMGHRPLLFFITLLFTILGSTARERGKHSDDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDNVKDTGETTGIEEPVLEGHLGVTKELLA
FQTPEKKCHIGCEKGANLIKELIDDFIFPASKVYLQCLRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDCLTEMYYMGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNNILAVEGTGSDIDDDMFSDEKQESESNVDPRDDVFGY
THQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAVLSQVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYIKGDLLEGANAYRCEKCDKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVPGVAKLEGDNVNPESQLLQQNEQSEIETAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGRDGERNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERLDTIDQDDEMIRYISDLTITKPHQI
MSPTIERSVRKKNVQFMHNRMQYSLEYFQFVKKLLTCNSIYLSPAPGQDHLLPEAEEITM
ISVQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFSE
YLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSSFTSPGPSGQACDHLSLSDHLLRAVLN
LLRREVSEHGRHLQQYFNLFVMYANLGIAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQY
AELGKLYSVVSQLIRCCNVSSRMQSSINGNPPLPNPFGDPNISQPIMPIQQNVADILFVR
TSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSDLLWQVAYSYTYELRPYLDLLLQ
ILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAY
QILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSHS
ARMTLAKACELCPEEEPDDQEAAEEHESSPPEDTPLYPHSSGSHYQQNNHVHGQPYTGPA
AHHLNNHQKVGQRAQENYEGNEEVSASQMKDQ
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaccactcgtggctctcctgtaggagggaatgacagccagggccaggctcct
gatggacattctcagcctctcttccagaatcagacctcatcaccagattcctccaatgag
aattccccagcaactcctccagatgaacaaggtcaaggtgatgctccaccacagcatgaa
gatgaggaacctgcttttccacatactgacctggcaaagttggatgacatgatcaaccgg
cctcgatgggtggttccagttttgccaaaaggcgaattagaagtgcttttagaagctgct
attgatcttagtaaaaaaggtcttgatgttcaaagtgaagcatgtcaacgtttttttcga
gatgggctaacaatatctttcactaaaattcttatggatgaggcagtgagtggctggaag
tttgaaattcataggtgcattattaacaatactcatcgcctagtggaactttgtgtggcc
aagttgtcccaagactggtttccacttctagaacttctcgcgatggccttaaatcctcat
tgcaaattccatatctacaacggtacacgtccatgtgaatcaatttcctcaagtgctcag
ttgtctgaagatgaactatttgctcgttcctcagatcctcgatcaccaaaaggttggcta
gtggatctcatcaataaatttggaacattaaatgggttccagattttgcatgatcgtttt
attaatggatcagcattaaacgttcaaataattgcagctcttattaaaccatttggacaa
tgctatgagtttctcagtcaacacacagtgaaaaaatattttattccaattatagaaata
attccacaatttttagaaaatttaactgatgaagaactgaaaaaagaagcgaagaatgaa
accaaaaatgatgccctttcaatgattattaaatctctgaagaatttagcttcacggatt
ccaggacaagaagaaactgtaaaaaatttagaaatttttaggttgaaaatgatacttaga
ttgttgcagatttcttcttttaatggaaagatgaatgcgctgaatgaaattaacaaggtc
atatctagtgtatcatattatactcataggcatggtaatcctgaggaggaagagtggctg
acagctgagcgaatggcagagtggatacaacagaacaaaatcttatccatagtcttacga
gatagtcttcatcaacctcaatatgtagaaaagctagagaagattcttcgttttgtgatt
aaagaaaaagctcttacattagaagatcttgataatatttgggcagcacagtcagggaaa
catgaagccattgtgaaaaatgtacatgatctcctggcaaagctggcttgggatttttct
cctgaacaacttgatcatctttttgattgctttaaggcaagttggacaaatgcaagtaaa
aaacaacgtgaaaagctgcttgagctgattcgacgtcttgctgaagacgataaagatggt
gtcatggcacataaagtgttgaaccttctttggaatctggctcatagtgatgatgtgccg
gtggacatcatggacctagctctcagtgcccacataaaaatactagattacagttgttca
caggatcgggacacacagaagatccagtggatagatcgttttatagaagaacttcgcaat
aatgacaagtgggtaattcctgcactgaaacaaataagagaaatttgtagtttgtttggt
gaggcacctcaaaatttgagtcaaactcagcgaagtccccatgtattttaccgtcatgat
ttaatcaatcaacttcagcacaatcatgccttagttactttggtagcagaaaaccttgct
gcttatatgaataacatgcgactatatgctagagaccatgaaggctatgacccacaaact
gtgaggcttggaagtagatatagtcatgttcaagaagttcaagaacggcttaacttcctc
agatttttattgaaggatggccaactctggctctgtgctcctcaggcaaaacaaatatgg
aaatgcttagcagagaatgcagtttacctttgtgatcgtgaagcctgttttaagtggtat
tccaagttaatgggggatgaaccagacttagatcctgatattaataaggatttttttgaa
agtaatgtgcttcagcttgatcctttcctgttaactgaaaatggaatgaaatgttttgaa
cgattcttcaaagctgttaactgtagagaagggaaactggtagcaaaaagaagaacctat
atgatggatgatttggaactaattggattagactacctttggagggttgtaatgcagagc
aatgatgacattgctagcagagctatagatctccttaaagagatatatacaaaccttggt
cccaggttacaggtcaatcaggtggttatccatgaggacttcattcagtcttgctttgat
cgtttgaaagcttcatatgatacattgtgtattttggatggtgacaaagatagtacaaat
tgtgcaagacaggaagccattcgaatggttcgagtattaactgttttaagggaatacata
aatgaatgtgatagtgattatcatgaggagagaaccattctacctatgtcaagagcattc
cgtggtaaacatctctctctaatagttcgatttccaaaccatggcagacaggttgatgac
ctggacatatggtctcataccaatgatactgttggttcagtacgtcgatgtattctcaat
cgtattaaagcaaatgtagcccatacaaaaattgaactctttgtgggtggtgagctgata
gattctgaagatgacagaaagctaattggacaattaaacttaaaagataaatcagtaatt
acagccaaacttacacaagtaagttccaatatgccttccagccctgatagttcttccgat
tcctcaactggatctcctggaaatatttgtcatcgctatagtgacggtcctaatccagaa
gtggaacgctgtttgcctggagtgataatgtcacaacatcccaggtatatctctttcctt
tggcaagttgcagatttaggtagcaatctgaatatgccacctcttagagatggagcaaga
atacttatgaaactcatgccaatagatagcacaacagtagaaaaattaagagctatttgt
ttggaccaggcaaaacttggagaaaataaccttggacagtctattgattcacttttcttt
ggtccttctgcttcccaagtcctatacctaacagaggtagtttatgccttgttaatgcct
gctggtacacctttggcagatgactcctctgactttcagtatcacttcttgaaaagtggt
ggcttacgccttgtgtatagtatgctgacaagaaataactttctgccaaatacagatacc
gaaacacgaaggggtgcttaccttagtggtcttaaaatagccaaactcttgctaactgct
ataggctatggccatgttcgagctgtagcagaagcttgtcatccagttgtagatggtgca
gatcctgtaactccgattaaccaagttactcatgatcaagcagtggtgctacaaaatgcc
cttcagagcattcctaatccatcatctgagtgcatgcttagaaacatatcaatacgtctt
gctcagcaaatatctgatgaggcttcaagatatatgcctgatatttgtgtacttagagcc
atacaaaaaatcatctgggcatcaggatgtggggcattagagctaatatttagccctaat
gaagaaatcactaaaatttatgagatgagcattaatgcaagcaaaggaccagacatggaa
gatgaacaggtttgctgtgaagcattggaagtgatgacattatgttttgctctaattcca
acagccctggatgctcttagtaaagaaaagtcctggcagacatttgtcattaacttatta
ttgcactgtcccagcaaaactgttcgtcaactggcacaggagcagttttttttaatgtgt
accagatgttgcatgggacacaggcctctgcttttcttcattactctgctctttaccatt
ttggggagcacagcaagagagagaggtaaacattcagatgactatttcactcttctacgg
caccttcttaattatgcttacaatagtaatattaatgtacctaatgctgaagttcttctc
aacaatgaaattgattggcttaaaagaattagggataatgttaaagacacaggagaaaca
acaggtattgaagagccagtattagaaggccaccttggagtaacaaaagagttattggct
tttcaaacgcctgagaaaaagtgtcatattggttgtgaaaaaggtgctaatctcattaaa
gaactaattgatgatttcatctttcctgcctccaaagtttacctacaatgtctgagaaat
ggagaactaccagctgagcaggccatcccagtttgtagttcaccggccaccatcaatgct
gggtttgaactgcttgtagcactagctgttggctgtgtaaggaatctcaaacagatagta
gattgtttgactgaaatgtattacatgggcacagcaataactacttgtgaagcacttact
gagtgggaatatctaccacctgttggaccccgtccaccgaaaggatttgtgggactcaaa
aatgctggagctacttgttacatgaattctgtgatccagcagctgtacatgattccttcc
atcaggaacaatattcttgcagttgaaggcacaggtagtgatatagatgatgatatgttc
agtgatgagaaacaagagagtgagagtaatgttgatccccgagatgatgtatttggatat
actcatcagtttgaggacaaaccagcattaagcaaaacagaagataggaaagagtacaat
attggtgtcctaagacaccttcaggtcatctttggtcatttggctgcttcccggctacaa
tactatgtgcccagaggattttggaaacagttcaggctttggggtgaacctgttaatcta
cgtgaacaacacgacgccttagagttttttaattctttggtggatagtttagacgaagct
ttaaaagctttaggacatccagctgttctaagccaagtcttgggagggtcctttgctgat
cagaagatttgccaaggctgcccacatagatacgagtgtgaagaatcttttacaactctg
aatgtagatatcagaaatcaccaaaaccttcttgattctttggaacagtatatcaaagga
gatttattggaaggtgcaaatgcataccgttgtgaaaaatgtgataaaaaggttgataca
gtaaagcgattgctaattaaaaaattgcctcctgttcttgctatccaattgaaaagattt
gactatgactgggaaagagaatgtgcaattaaattcaatgattactttgaatttcctcga
gagctggacatggaaccttacacagtaccaggggttgcaaagctggaaggagataatgta
aatccagagagtcagttgttacaacagaatgagcaatctgaaattgagacagcaggaagc
acaaaatacagacttgtaggggtgcttgtacacagtggtcaagcaagtggtggacattat
tattcctacatcattcaaaggaatggtagagatggtgagagaaatcgctggtataaattt
gatgatggagatgtaacagagtgtaaaatggatgatgatgaagaaatgaaaaatcagtgt
tttggtggagagtacatgggagaagtatttgatcatatgatgaaacgcatgtcatacagg
cgacagaaaaggtggtggaatgcttatatactcttttatgaacgattagacacaatagac
caagatgatgagatgatcagatatatatcagacctaactatcacaaaaccccatcagatt
atgtcaccaaccattgagagaagtgtgcggaaaaaaaatgtgcaattcatgcataaccga
atgcagtacagtttagaatattttcaatttgtgaaaaaactgcttacgtgtaatagtatt
tacttaagccctgctccaggacaagatcacttgttgcctgaagcagaagaaatcactatg
attagcgttcagcttgcagctaggttcctctttaccactggatttcacaccaagaaaata
gtccgtggccctgccagtgattggtatgatgcactgtgcattctacttcgtcacagcaag
aatgtacgtttttggtttgctcataatgtccttttcaatgtttcaaatcgtttctctgaa
tatcttctggagtgccctagtgcagaagtgaggggtgcttttgcaaaacttatagtattt
attgcacatttttctttgcaagatgggccttgtccttcatctttcacatctccaggacct
tctggtcaggcatgtgatcacttaagcttgagtgatcacttactaagagcagtattaaat
cttctgagaagggaagtttcagagcatggccgtcatttacagcaatatttcaatctgttt
gtaatgtatgccaatttaggcatagcagaaaagacacagcttctgaagttgagcgtacct
gctacctttatgcttgtgtctttagatgaaggaccaggtcctccaatcaaatatcagtat
gctgaattaggcaagttgtactcagtagtgtctcaactgatccgctgctgcaatgtttcc
tcaagaatgcagtcttcaatcaatggtaatcctcctcttcccaatccttttggtgatcct
aatatatcacagcctataatgccaattcagcagaatgtggcagacattttatttgtgaga
acaagttacgtaaagaaaatcattgaagactgtagtaactcagaggaaaccatcaaatta
cttcgtttttgctgctgggagaatcctcagttctcctctactgtccttagtgaccttctc
tggcaggttgcatattcatacacctatgaacttcggccatatttggatctacttctgcag
attttactgatagaggattcctggcagactcacagaattcataatgcacttaaaggaatc
ccagatgatcgagatgggttgtttgacactatccaacgctctaagaatcactatcaaaaa
agagcataccagtgtataaaatgtatggtagctctctttagcagctgtcctgttgcttac
cagatattgcagggtaatggagaccttaaaagaaagtggacctgggcagtggaatggctt
ggagatgaacttgaaagaagaccatatactggcaatcctcaatatacttataataattgg
tctcctccagtgcaaagcaatgaaacatcaaatggttatttcttagagagatcacatagt
gctaggatgacactggcaaaagcttgtgaactctgtccagaggaggagccagatgaccaa
gaagctgcagaagaacatgaatcatctcccccagaagataccccattatatcctcattca
tccggatctcactatcagcagaacaatcacgttcacggacagccatatacagggccagca
gcacatcacttaaacaaccatcagaaagttggccaacgagcacaagaaaattatgaaggc
aatgaagaagtatccgcatctcaaatgaaggatcagtga

DBGET integrated database retrieval system