KEGG   Sus scrofa (pig): 100625317Help
Entry
100625317         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100625317
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100625317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 502 aa AA seqDB search
MHSFRKKKNYGLFAVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGG
TLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLG
NTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIP
PIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDTVKETDSSSA
SAVTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLK
LRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPL
MLDVYELCTPELXXXXXSFRSKFKDLEDKKVNQQPKASDKKSSPQKEVKYEPFSFADDIG
SNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGD
WHIAYVLLYGPRRVEIMEEESE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctttcggaagaaaaaaaattatggtttatttgcagttactgtgaaatgggga
aaggagaaatttgaaggtgtggaactgaatactgatgaacctcccatggtgttcaaggct
cagctttttgcattgactggagtccagccggccagacagaaagttatggtaaaaggagga
actctgaaggatgatgattggggaaacatcaaaataaaaaatggaatgactttactaatg
atggggtcagcagatgcgcttcctgaggaaccctcagctaaaactgtcttcgtagaagac
atgacagaagaacagctggcatctgctatggaattaccatgtggattgacaaaccttggt
aacacttgttacatgaatgctacagttcagtgtattcgttctgtgcctgaactcaaagat
gcccttaaaaggtatgcaggtgccttaagagcttcaggggagatggcttcagcacagtat
attactgcagcccttagagatttgtttgattccatggataaaacttcttctagtattcca
cctattatcctactgcagtttttgcacatggcttttccacagtttgcagaaaagggcgaa
caaggacagtatcttcaacaggatgctaacgaatgttggatacaaatgatgcgagtattg
caacagaaattggaagccatagaggatgatactgttaaagagacagattcttcatctgca
tcagcagtgacgccttctaaaaagaaaagtttaatcgatcagttcttcggagttgagttt
gaaaccaccatgaaatgtacagaatctgaagaagaagaagtcactaaaggaaaggaaaat
cagcttcagcttagctgttttatcaatcaggaagtcaagtatctttttacaggacttaaa
ttgcgacttcaggaagaaattaccaaacagtctccaacattgcaaagaaatgctttgtac
atcaaatcttccaagattagccggctacctgcttacttgactattcagatggttcgattt
ttttataaagagaaggagtctgtaaatgctaaagttcttaaggatgttaaatttcctctt
atgttggatgtgtatgaactgtgtacaccagaactnnnnnnnnnnnnnnnttcttttcga
tcaaaattcaaggatctagaagataaaaaagtaaatcagcagccaaaggcaagtgacaaa
aagagtagtccccaaaaagaagttaagtatgaacccttttcttttgctgatgacattggc
tccaataattgtggatactatgacttacaagcagtgctaacacatcagggaaggtctagc
tcttcaggccattatgtatcgtgggtgaaaaggaaacaagatgaatggattaagtttgat
gatgataaggtcagcatcgtgacaccagaggatatcttgcggctttctggtggtggagac
tggcatatagcttatgttctactgtatggccctcgcagagttgaaataatggaagaggaa
agtgaatag

DBGET integrated database retrieval system