KEGG   Sus scrofa (pig): 100625479Help
Entry
100625479         CDS       T01009                                 

Definition
(RefSeq) cytochrome P450 1B1
  KO
K07410  cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00140  Steroid hormone biosynthesis
ssc00380  Tryptophan metabolism
ssc00980  Metabolism of xenobiotics by cytochrome P450
ssc04913  Ovarian steroidogenesis
ssc05204  Chemical carcinogenesis
ssc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100625479
  Amino acid metabolism
   00380 Tryptophan metabolism
    100625479
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100625479
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100625479
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100625479
   05204 Chemical carcinogenesis
    100625479
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100625479
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP1 family
   100625479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100625479
NCBI-ProteinID: XP_020943279
Position
3
AA seq 543 aa AA seqDB search
MATSLSLYDHLLPIPLSVQQTTLLLLLSVLAAVHVGQWLLRQRRRQPGSAPPGPFAWPLI
GNAASMGPAPHLSFARLARRYGDVFQIRLGSCPVVVLNGERAIRQALVQQSVAFADRPPF
ASFRVVSGGRSLAFGQYSESWKAQRRAAHSTMRAFTTRQPRGCRVLERHVVGEARELVSL
LVRGSAGGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDAEFRELLSHNEEFGRTVGAGSL
VDVLPWLQRFPNPVRTTFREFEQLNRNFSNFVLDKFLRHRESLRPGAAPRDMMDAFILSA
GKEAAAGSGDAGARPDVEYVPATVTDIFGASQDTLSTALQWLLILFIRYPEVQARVQAEL
DQVVGRDRLPCLEDQPHLPYVMAFLYEAMRFSSFVPVTIPHATLANASVLGYHIPKDTVV
FVNQWSVNHDPVKWSNPEDFDPARFLDKDGLINKDLASSVMIFSVGKRRCIGEELSKIQL
FLFISILAHECNFRANPDELLKMDFNYGLTIKPKSFKVNVTLRESLELLDRAVQKLQAEE
NDQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcctcagcctgtacgatcacctgctgcccatcccgctgtcggtccagcag
accacgctcctgctgctcctctcagtcctggcggcggtgcacgtgggccagtggctgttg
aggcagcggcggcggcagccagggtccgcgccaccgggtcccttcgcttggccgctgatt
ggaaacgcggcgtctatgggccctgcgccgcacctctctttcgctcgcctggctcggcgc
tacggcgatgtcttccagatccgcctgggcagctgcccggtggtggtgctgaacggcgag
cgcgccatccgccaggccctggtgcagcagagcgtcgccttcgccgaccggccgcccttc
gcctccttccgtgtggtgtccggtggccgcagtctggcgttcggccagtattcggagagc
tggaaagcgcagcggcgcgcggcgcacagcacgatgcgagccttcaccacgcgccagcct
cgcggctgccgggtcctcgaaagacacgtggtgggcgaggcacgggagttggtatcgctg
ctcgtgcgcggcagcgcgggcggcgccttcctggacccgcggccgctgaccgtggtggcg
gtggccaatgtcatgagcgccgtgtgtttcggctgtcgctacagccacgacgacgccgag
ttccgcgagctgctcagccacaacgaggagttcgggcgcactgtgggcgcgggcagccta
gtggacgtgctgccctggctgcagcgcttccccaaccccgtgcgcaccaccttccgcgaa
ttcgagcagctcaatcgcaacttcagcaactttgtcctagataagttcctgaggcaccgc
gagagccttcggcccggagccgccccccgcgatatgatggatgccttcatcctttccgcg
ggaaaggaggccgccgcgggctcgggcgacgccggcgcgcggccggacgtggagtacgtg
ccggccaccgtcacagacattttcggtgccagtcaggatactctctccaccgcgctgcag
tggctgctcatcctcttcatcaggtatccggaagtgcaggctcgggtacaggcagagctg
gatcaagtggttggtcgggaccggctgccctgcctggaggaccaaccccacctgccctac
gtcatggcctttctttatgaagccatgcgcttctctagctttgtacccgtcaccattccc
catgccactttggccaatgcctcggtcttaggctaccacatccccaaggacacagtggtt
tttgttaaccagtggtctgtgaatcatgacccggtgaagtggtctaacccagaagacttt
gatccagcccgattcctggacaaggacggcctcatcaacaaggacctggccagcagcgtg
atgattttctcagtgggcaaacggcggtgcatcggggaagagctttccaaaatacagctg
tttctcttcatctccatcctggctcatgagtgcaatttcagggccaatccagatgagctc
ttgaaaatggattttaattacggcctgaccattaaacccaagtcatttaaagtcaatgtc
acactcagagagtccctggagctccttgatagagctgtccaaaagttacaagcagaggaa
aatgaccagtga

DBGET integrated database retrieval system