KEGG   Sus scrofa (pig): 100625751Help
Entry
100625751         CDS       T01009                                 

Definition
lactosylceramide alpha-2,3-sialyltransferase-like
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
ssc  Sus scrofa (pig)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100625751
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     100625751
Glycosyltransferases [BR:ssc01003]
 Terminal extension
  Sialyltransferase
   100625751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 214 aa AA seqDB search
MPKSLLNSDLCDSFQRAQKYAQQVLQKECRPHFAKRSMAQLFGPRYSTDLPPFVTKAPLG
SKAESKYDPPFGFRKFSSKVQALLELLPEHDFPEHLTAKSCRRCVVIGSGGILHGLELGP
ALNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDF
NWLQAMVKNETLVSTSRSALKHAFVQREGVSDWR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagagccttttaaactcagatctgtgtgattctttccagagagcacagaaatac
gcccagcaagtcctgcagaaggagtgccggccccactttgccaagaggtcgatggcacag
ctcttcggccccaggtacagcacggacttaccgcctttcgtgacaaaagcccccttgggg
agcaaggctgagtccaagtacgaccctcctttcggattccgaaagttctccagtaaagtc
caggccctcttggaactcttgcctgagcatgactttcctgaacacttgacagccaagagc
tgtaggcgttgtgtggtcatcggaagcggtggaatcctccacgggctagagctgggccca
gccctgaaccagttcgacgtggtgataaggttaaacagtgcaccagttgaaggatattca
gagcatgttggaaataaaactactataaggatgacttacccagagggggcaccactgtct
gaccttgaatattattccaatgacttgtttgttgctgttttatttaagagtgttgacttc
aactggcttcaggcaatggtcaaaaacgaaaccctggtaagcacgagccgttcagctctc
aaacatgcctttgtacaaagggaaggggtctctgattggcgttaa

DBGET integrated database retrieval system