KEGG   Sus scrofa (pig): 100625751Help
Entry
100625751         CDS       T01009                                 

Gene name
ST3GAL5
Definition
(RefSeq) lactosylceramide alpha-2,3-sialyltransferase isoform X1
  KO
K03370  lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00604  Glycosphingolipid biosynthesis - ganglio series
ssc01100  Metabolic pathways
Module
ssc_M00069  Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100625751 (ST3GAL5)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     100625751 (ST3GAL5)
Glycosyltransferases [BR:ssc01003]
 Terminal extension
  Sialyltransferase
   100625751 (ST3GAL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100625751
NCBI-ProteinID: XP_020942952
Ensembl: ENSSSCG00000008227
Position
3
AA seq 420 aa AA seqDB search
MRTKASGCTERRPLQPQTEAAEAAAPAGRAMPSESNCVKLRSDRARPSLPWYPRAQSKMR
RPSLLLKDILKCILLVFGVWILYILKLNYTTEECDMKKMHYVDPDRIKRAQKYAQQVLQK
ECRPHFAKRSMAQLFGPRYSTDLPPFVTKAPLGSKAESKYDPPFGFRKFSSKVQALLELL
PEHDFPEHLTAKSCRRCVVIGSGGILHGLELGPALNQFDVVIRLNSAPVEGYSEHVGNKT
TIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKNETLPFWVRLFFWKQVAEK
IPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSL
AGFGYDLNQPRTPLHYFDNLCMAAMNFQTMHNVTTETRFLLKLVREGVVRDLSGGIHCEF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgaaagcgtcaggctgcaccgagcggcgtcccctgcagccgcaaaccgaggcg
gcggaggcggcggcacctgccggccgagcaatgccaagtgagtccaactgtgtgaagctg
aggagcgaccgtgcgaggccttccttgccatggtacccccgagcccagagcaagatgaga
agaccgagcttgctgttaaaagacatcctcaagtgtatattgcttgtgtttggagtgtgg
atcctttatatcctcaagttaaattatactactgaagaatgtgacatgaaaaaaatgcat
tatgtggaccccgaccgcataaagagagcacagaaatacgcccagcaagtcctgcagaag
gagtgccggccccactttgccaagaggtcgatggcacagctcttcggccccaggtacagc
acggacttaccgcctttcgtgacaaaagcccccttggggagcaaggctgagtccaagtac
gaccctcctttcggattccgaaagttctccagtaaagtccaggccctcttggaactcttg
cctgagcatgactttcctgaacacttgacagccaagagctgtaggcgttgtgtggtcatc
ggaagcggtggaatcctccacgggctagagctgggcccagccctgaaccagttcgacgtg
gtgataaggttaaacagtgcaccagttgaaggatattcagagcatgttggaaataaaact
actataaggatgacttacccagagggggcaccactgtctgaccttgaatattattccaat
gacttgtttgttgctgttttatttaagagtgttgacttcaactggcttcaggcaatggtc
aaaaacgaaaccctgccattttgggtacgactcttcttttggaagcaagtggcggaaaaa
atcccactacagcccaaacacttcaggattttgaatccagttattatcaaagagactgcc
ttcgacatccttcaatactcagagcctcagtcaaggttctggggccgagataagaacgtc
cccacgattggtgtcatcgctgtggtcttagccacacatctgtgcgatgaagtcagttta
gcaggctttggatacgacctcaaccaacccagaacgcccttgcactactttgacaatctc
tgcatggctgccatgaattttcagaccatgcacaatgtgacaacagagacccggttcctc
ctgaagctggtcagagagggcgtggtgcgggatctcagcggaggcatccattgtgaattc
tga

DBGET integrated database retrieval system