KEGG   Sus scrofa (pig): 100625904Help
Entry
100625904         CDS       T01009                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 659 aa AA seqDB search
MEGKKLQLGIEEDLEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQTQEKPNTTIQVPAFLQ
ELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKW
LDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKEC
VVERCRVLRLKNQLNEDYKTVNNLLKATVKGSDGFWVGKSSLRSWRQLALEQLDEQDAEA
DQSNGKMNGNTLNKDESKEERKEEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQ
QYFPKAPEFPSFKECCSQCKILEREGEENEALHKRIANEQKTSLPNLFQDKNRPCLSNWP
EDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLI
ALIWPSEWQMIQKLFVVDHVIKITRTEVGDTDPPETQYISEPKLCPECREGLLCQQQRDL
REYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKR
QKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLS
IDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaagaaattacaactagggattgaggaagatctagaaccttctaagtcccag
acacgtaaacccaagtgtggcaaaggaactcactgctctcgaaatgcttacatgttggtt
tataggctacaaactcaagaaaagcccaacaccactattcaggtaccagcctttcttcaa
gagctggtagatcgggataattccaaatttgaggagtggtgtattgaaatggccgagatg
cgtaagcaaagtgtggataaaggaaaagcaaagcatgaagaagttaaggagctgtaccaa
aggttacctgctggagctgagccctatgaatttgtctctcttgagtggctgcagaagtgg
ctggatgaatcgacacccaccaagcctatcgataatcacgcttgcctatgttcccacgac
aagctccatcctgataaaatatcgattatgaagagaatatctgaatacgcagctgacatt
ttctacagtagatatggaggaggaccaagactaactgtgaaagccctgtgtaaggaatgt
gtggtagaacgctgtcgtgtgttgcggctgaagaaccaactaaacgaagattataaaact
gtaaataatctgcttaaagcaacagtaaagggcagtgatggattttgggtgggaaaatcc
tctttgcgcagttggcgccagctggctcttgaacagctagatgagcaagatgctgaagca
gaccaaagcaatggaaaaatgaatggcaacaccttgaataaagatgaatcaaaagaagaa
agaaaagaagaggaggaagaattaaattttaatgaagacattctgtgcccacatggggag
ttatgcatatctgaaaatgaaagaaggcttgtttctaaagaggcttggagcaagctgcag
cagtactttccaaaggctcctgagtttccaagtttcaaagaatgctgttcccagtgcaag
attttagaaagagaaggggaagaaaatgaagccttacataagaggattgcaaacgagcaa
aaaacttctcttccaaatttgttccaggacaaaaacagaccttgtctcagtaactggcca
gaggacacggatgtcctctacattgtgtcccagttctttgtagaagaatggcggaaattt
gttagaaaacctacaagatgtagccccgtgtcatcggttggaaacagtgcccttctgtgt
ccccacgggggcctcatgtttacattcgcttccatgaccaaagaagattctaaacttata
gctctcatatggcccagtgagtggcaaatgattcaaaagctctttgttgtggaccatgta
attaaaatcacgagaactgaagtgggagacacagaccctccagaaacacagtatatttct
gagcctaaactctgtccagaatgtagagaaggcttattgtgtcaacagcagagggacctg
cgtgaatacactcaagccaccatctatgttcataaagtcgtggataataagaaggtgatg
aaggattcagctccggaactaaatgtgagtagttctgaaacagaggaggacaaggaagaa
gctaagccagacggagaaaaagatccagattttaatcaaagcaacggaggaacaaagcgg
cagaagatatctcatcaaaattatatagcctatcaaaagcaagttattcggcggagtatg
cgacatagaaaagttcgtggtgaaaaggcacttcttgtttctgctaatcaaacattaaaa
gaactgaaaattcagatcatgcatgcattttcagttgctccttttgaccagaacctgtcc
attgacggaaagattttaagtgatgactgtgccaccctcggaacccttggcgtcattcct
gaatctgtcattttgttaaaggctgatgaaccaattgcagattatgctgcaatggatgat
gtcatgcaagtgtgtatgccagaagaagggtttaaaggtactggtctgcttggacattaa

DBGET integrated database retrieval system