KEGG   Sus scrofa (pig): 100625946Help
Entry
100625946         CDS       T01009                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04015  Rap1 signaling pathway
ssc04218  Cellular senescence
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04668  TNF signaling pathway
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04912  GnRH signaling pathway
ssc05014  Amyotrophic lateral sclerosis (ALS)
ssc05145  Toxoplasmosis
ssc05164  Influenza A
ssc05167  Kaposi's sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05418  Fluid shear stress and atherosclerosis
Module
ssc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100625946 (MAP2K6)
   04010 MAPK signaling pathway
    100625946 (MAP2K6)
   04668 TNF signaling pathway
    100625946 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100625946 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100625946 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100625946 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100625946 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100625946 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100625946 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100625946 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100625946 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100625946 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100625946 (MAP2K6)
   05169 Epstein-Barr virus infection
    100625946 (MAP2K6)
   05145 Toxoplasmosis
    100625946 (MAP2K6)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100625946 (MAP2K6)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100625946 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase Choline_kinase DUF4344 APH
Motif
Other DBs
NCBI-GeneID: 100625946
NCBI-ProteinID: XP_013836270
Ensembl: ENSSSCG00000017254
Vega: OTTSUSG00000001677
UniProt: F1RV28
Position
12
AA seq 334 aa AA seqDB search
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKSILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaatcccaaaagaagcattt
gaacaacctcagaccagttccacgccacctcgagacttagactccaaagcttgcatttct
attggaaatcagaactttgaggtgaaggcggatgacctggagcccatagtggaactggga
cgaggtgcgtacggggtggtggagaagatgcgacacgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaacagccaggagcagaaaaggctactgatggatctg
gatatttccatgaggaccgtggactgtccttttacggtcaccttctacggcgcactcttc
cgtgagggtgatgtctggatctgcatggagctcatggatacgtccctagataaattctac
aaacaagtgattgataaaggccagacgattccagaggacatcttaggaaaaatagcagtt
tctattgtaaaagcgttagaacatttacacagtaagctctctgtcattcatcgagacgtc
aagccttccaacgtcctgatcaacactctgggccaagtgaagatgtgcgacttcggaatc
agcggctaccttgtcgactccgtcgccaaaactattgatgcaggatgcaaaccgtacatg
gcgcccgagagaataaacccagagctcaaccagaagggatacagtgtgaagtccgacatt
tggagtctgggcatcaccatgatcgagttggccatccttcggtttccctacgactcgtgg
ggaactccttttcagcagctcaaacaggtggtggaggagccatcgccacagctccccgca
gacaagttctccgaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaaaggccaacatatccagagcttatgcaacatccgtttttcaccctacatgaatccaaa
gcaacagacgtggcatcttttgtaaaatcaattctcggagactaa

DBGET integrated database retrieval system