KEGG   Sus scrofa (pig): 100626023Help
Entry
100626023         CDS       T01009                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ssc  Sus scrofa (pig)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100626023 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100626023 (SPHK2)
   04020 Calcium signaling pathway
    100626023 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100626023 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100626023 (SPHK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100626023 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 617 aa AA seqDB search
MAPPPPLPLTASTPLLHGEFGSYPARGPRFALTLTPQALHIQRLRPKPEARPRGGLVLLA
EVSGCCTLRSRSPSDSAAYFCIYTYPRGRRGGRRRAARTFRADEAATYEENRAEAQRWAT
ALTCLLRGLPLPGDGDITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSF
NLIQTERQNHARELVQGLSLSEWDGIVTVSGDGLLYEVLNGLLDRPDWEEAVKTPVGILP
CGSGNALAGAVNQHGGFEPALGIDLLLNCSLLLCRGGGRPLDLLSVTLASGSRCFSFLSV
AWGFISDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHGLP
RAKSELTLAPAPAPPVAHSPLHRSVSDLPLPLPTLTSPGSPEPLPVLSLNGGCPELAGDW
GGAGDAPLSPDPLLPSPPGSPKAAQLSPITEGAPEMPASSELLPPTPDIPVAISTGGPPD
HLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISR
AALLRLFLAMEHGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHP
GLGTLLTGPPGCLGREP
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggcccccccaccgccactgcccttgaccgccagcaccccactcctgcatggcgagttt
ggttcctacccagcccgaggcccacgctttgccctcactctcacaccacaagccctgcac
atccagcggctgcgcccgaagcctgaagcccggccacggggtggcctggtcctgctggcc
gaggtctcaggctgctgcaccctgcggagccggagcccctcagactcggcagcctacttc
tgcatctatacctacccgaggggccggcgcgggggccggcgcagagctgcacgtaccttc
cgagccgacgaggcagccacctatgaggagaaccgtgctgaggcccagcgctgggccact
gccctcacgtgtctgctccgcgggctgccgctgcctggggacggggacatcacccctgac
cttctgcctcggccgccccgattgctcctactggtcaatccctttggggggcggggcctg
gcctggcagtggtgtaagaaccacgtgctgcccatgatctctgaagctgggctgtccttc
aacctcatccagacagaacgacagaaccacgcccgggagctggtccaggggctgagcctg
agcgagtgggacggcatcgtcacagtctcgggagatgggctgctgtacgaggtgctgaat
ggactcctagatcgccccgactgggaagaggctgtgaagaccccagtgggcatcctgccc
tgtggctctggcaacgcactggcaggagctgtgaaccagcatggggggtttgagccggcc
ctgggcattgacctgctgctcaactgctctttgctgctctgccggggtggcggccgccca
ctggacctgctctcggtgacgctggcctccggctcccgctgtttctccttcctgtctgtg
gcatggggcttcatatcagacgtggatatccagagcgagcgcttcagagccctgggcagt
gctcgcttcacactgggcacagtgctgggactggctacactgcacacctaccgcggccgc
ctctcctacctccctgccaccgtggaacctgcctcacccactcctgcccatggtctgcca
cgtgccaagtcagagttgaccctggccccggccccagccccacccgtggcccactcaccc
ctgcatcgctctgtgtctgacctgcccctgcccctgcctaccctaacctctcctggctca
cctgaacccctacctgtcctgtccctcaatggtgggtgcccagagctggctggtgactgg
ggtggggctggggatgccccgctatccccagatccactgctgccctcgccccctggctcc
cccaaggcagctcaactttcacccatcaccgagggggccccagaaatgccagcatcctct
gagctcctgcctcccacccctgatatcccagtagccatctccactgggggcccacccgac
cacctgctccctcctctgggcactccactacccccagactgggtgacattggagggggac
tttgtgcttatgttggccatctcacccagtcacctaggggctgacctggtggcagccccc
cacgcacgctttgacgacggcttggtgcacctgtgttgggtgcgcagcggcatctcgcgg
gcagcactgctgcgcctttttctggccatggagcacggcagccacttcagcctgggctgt
ccgcagctgggctatgccgcggctcgtgccttccgcctcgagcctctcacgccccgcggc
gtgctgacagtggacggggagcaggtggagtatgggccattgcaggcgcagatgcatccg
ggccttggtacactgctcactggtcctccggggtgccttgggcgggagccctga

DBGET integrated database retrieval system