KEGG   Sus scrofa (pig): 100626053Help
Entry
100626053         CDS       T01009                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100626053 (USP28)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100626053 (USP28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1082 aa AA seqDB search
MTAELQQDDAAGAADRHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQTDG
RDLNRMPEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLPEFRRLVLGYSRPQNALENCPSHAEKRNIVFMQELQYLFALMIGSNRKFVDPSAALD
LLKGAFRSPEEQQQDVSEFTHKLLDWLEDAFQLAVNVNNPRNKSENPMVQLFYGTFLTEG
VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDLETLPSDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRSKRECIRKLKEEIK
VLQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESTLSQSDACMTSPVSSVHCAA
SDLTSEESTSKEGTSQDAESTFSSSEDSAHKSKPVNQPLPPSRSSMEMPAHPAPRTVTDE
EINFVKTCLQRWRSEIEQDIQDLKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQA
NAGHYWAYIYNQPRQVWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHCH
AESAPNELDQMSGEVEALSVELKHYIQEDNWRFEQEIEEWEEEQSCKIPQMDSSTSSASQ
EFSPSQESSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALSEVMLSPAM
QGVILAIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQN
EAPKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLF
RKVSVYLLTGLELYQKGKYQEALSYLVYAYQSNAALLLKGPRRGVKESVIALYRRKCLLE
LNAKAASLFETNDEHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEIMRNHWCSYLG
QDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVT
VK
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggagctgcagcaggacgacgcggccggagcagcggaccgccacggctcgagc
tgccaaatgctgttaaaccaactgagagaaattacaggcattcaggacccttcttttctc
catgaagctctaaaggccagtaatggtgacatcacccaggcagtcagccttctcactgat
gaaagagttaaagagcccagccaagacactgttgcgacagagccatctgaagtcgagggc
agtgctgccaacaaagaggtgttagcaaaagttatagaccttactcatgataacaaagat
gatcttcaggctgccattgctttgagtcttttggagtcccccaaaattcaaactgatgga
agagatcttaacaggatgcccgaggcaacttctgcagaaactaaacgctcaaagagaaaa
cgctgtgaagtctggggagaaaatcccaatcccaatgactggaggcgagtggatggctgg
ccagttgggctgaaaaatgttggcaatacgtgttggtttagtgctgttattcagtctctc
tttcagttgcctgaattccgcagactcgtcctcggctatagtcgaccacagaacgcactt
gaaaactgtccaagtcacgcggaaaagagaaatatcgtgtttatgcaggagcttcagtac
ttgtttgctctgatgataggatcaaatcgcaagttcgtagacccctcagcagccctggac
ctcttaaagggagcgttccgatcacctgaggaacagcagcaagatgtgagtgaattcaca
cacaagctcctggattggctagaggacgcattccagctagccgttaatgttaacaatccc
aggaacaaatctgaaaatccaatggtgcagctattctatggtaccttcctcactgaaggg
gttcgtgaaggaaagccattttgtaacaacgagaccttcggccagtacccccttcaggta
aatggttatcgcaacttagacgaatgtttggaaggggccatggtggagggtgaccttgag
acacttccttccgatcattcagtgaagtatggacaagagcgttggtttacaaagctacct
ccagtgttgacttttgaactctcaagatttgagtttaatcagtcccttggtcagccagag
aaaattcacaataagctggaatttcctcagatcatttatatggacaggtacatgtacagg
agcaaagagcttattcgaagtaagagggagtgtattcgaaagttgaaagaagaaataaaa
gttctgcagcaaaaactggaaaggtatgtcaagtacggctcgggcccggctcggttccct
ctcccggatatgctgaagtacgtgattgaatttgctagtacaaaacctgcctcagaaagc
actttgtctcaaagtgacgcatgcatgacatcaccagtgtcttcagtgcactgcgcagct
tctgacctgacatccgaggaaagtacaagtaaagagggcacgtctcaggatgctgagagt
accttttcttcttctgaagattctgcacacaagtctaagccagtgaatcagccccttcca
ccttcccggtcttccatggaaatgcctgcacatccagctcctcgaacggtcacagatgag
gagataaactttgttaagacctgccttcagaggtggaggagtgaaattgaacaagatata
caagatctaaagaattgtattgcaagcactacgcagactattgagcagatgtactgtgat
cctctcctccgccaggtgccttaccgcttgcatgcggttcttgttcatgagggacaagca
aacgcaggacactactgggcgtacatctataatcagccccggcaggtctggctcaagtac
aacgacatctccgttactgagtcttcctgggaagaactcgaaagagactcctatgggggc
ctgagaaacgtcagtgcttactgtctgatgtacattaatgacaagctgccgcactgccat
gcagaatcagccccaaatgaattggatcagatgtcaggagaggtggaagccctctctgtt
gaacttaagcattacattcaggaagataactggaggtttgagcaagaaatcgaggagtgg
gaagaagagcagtcttgcaaaatccctcaaatggactcttccaccagctcagcatcacag
gagttctctccatcgcaagagtcttcagtagcctcttcccatggggttcgctgcctgtcc
tcggagcacgccgtgatcgtgaaggaacagactgcccaggctatagcaaacacggcccgc
gcctacgagaagagtggggtagaagcagcattgagtgaggtgatgctgagccctgccatg
caaggggtcatcctggccatagctaaagcccgtcagacctttgaccgagacgggtctgaa
gcagggcttattaaggcattccatgaagagtactccaggctctatcagcttgccaaggag
acccccacctctcacagtgacccccgacttcagcacgtgcttgtctacttcttccaaaat
gaagcacccaagagggtagtagagcggaccctgctggaacagtttgcagataaaaatctt
agctacgatgaaaggtccatcagcattatgaaggtggctcaagcgaaactgaaggagatt
ggtccagatgacatgaatatggaggagtacaagaagtggcatgaagattatagtttgttt
cgaaaagtgtctgtgtatctcctgaccggcctggaactctatcagaaaggaaagtatcag
gaggcgctttcctacctggtgtacgcttaccagagcaatgctgctctgctgctgaagggg
cctcgccgcggcgtgaaggagtccgtgatcgctttataccgaagaaaatgccttctggag
ctaaatgccaaagcggcttctctctttgaaacaaatgatgaacactctgtaacagagggt
attaatgtgatgaatgaattgatcattccctgcattcaccttatcattaataatgacatc
tccaaggatgacctggatgccattgagatcatgagaaaccattggtgctcttaccttggg
caagatattgcagaaaatctgcaactgtgcttgggggagtttctacccaggcttctagat
ccttctgcagaaatcattgtcttgaaggagcctccaactattcgacccaattctccctat
gacctttgcagccgatttgcagctgtcatggagtcaattcaaggagtgtcaactgtgaca
gtgaaataa

DBGET integrated database retrieval system