KEGG   Sus scrofa (pig): 100626093Help
Entry
100626093         CDS       T01009                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
ssc  Sus scrofa (pig)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100626093 (RASGRP2)
   04015 Rap1 signaling pathway
    100626093 (RASGRP2)
   04010 MAPK signaling pathway
    100626093 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100626093 (RASGRP2)
   04062 Chemokine signaling pathway
    100626093 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 608 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSSSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPLELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMVLSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALLVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFHESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAHSPSPTHTHHRAFSFSLPRPGRRGSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaccctagacctggacaagggctgcaccgtggaggagctgctccgtggctgc
atcgaagctttcgatgactccgggaaggtgcgggacccgcagctggtgcgtatgttcctc
atgatgcacccctggtacatcccttcctctcagctggcggcgaaactgctccacatctac
caacaatcccggaaggacaactccagttcgctgcaggtgaaaacatgccatctggtcagg
tactggatctcagcattcccagcggagtttgatttgaatcctgagctcgctgagcagatc
aaggagctgaaggctctactagaccaggaagggaaccgccgtcacagcagcctcatcgac
atcgagagcgtccccacctacaagtggaagcggcaggtgacccagcggaacccggtggga
cagaaaaagcgcaagatgtccctgctgtttgaccacttggagcccctggagctggcggag
catcttacgtacttggagtatcgctctttctgcaagatcctgttccaggactatcacagt
ttcgtgactcatggctgcactgtggacaaccctgtcctggagcgattcatctccctcttc
aacagcgtctcccagtgggtgcagctcatggttctcagcaagcccaccgcgccgcagcgg
gccctggtcatcacgcacttcgtccacgtagcagagaaactgctgcagctgcaaaatttc
aacacgctgatggcggtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgtgagcccagagaccatcaagctctgggaaggtctgacggaactagtg
acagccaccggcaactatggcaactaccgacgccggttggcagcctgtgtgggtttccgc
ttccccatcctgggtgtgcacctcaaggatctggtggccctgcagctggcactgcctgac
tggctggatcccgcccggacccgactgaatggggccaagatgaagcagctcttcagcatc
ctggaggagctggccatggtgaccagccttcggcccccagtgcaggccaatcctgacctg
ctgagcctgctcacggtgtctttggatcagtatcagacggaggatgagctctaccagctg
tcactgcagcgggaacctcgctccaagtcctcgccgaccagccccacgagctgcacgccg
cctccccggcccccagtgctggaggagtggacctcggtggccaaacccaagctggatcag
gcgctgctggtggaacacattgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggacggccacatctcgcaggaggagttccagatcatccgtgggaactttccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtttcctacttcctgcggtccagctccgtgctggggggccgcatgggcttcgtacacaac
ttccacgagagcaactccttgcgcccggtcgcctgccgccactgcaaggccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaagatcgcctgtcagtcgagtgtcggcgccgggcgcagagtgtgagtctggaggggtct
gcacactcaccctcacccacccacacccaccatcgggccttcagcttctccctgccccgc
ccaggcaggcgaggctcccggcctccagagatccgagaggaggaggttcagacggtggag
gatggcgtcttcgacatccacttgtaa

DBGET integrated database retrieval system