KEGG   Sus scrofa (pig): 100626246Help
Entry
100626246         CDS       T01009                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100626246
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100626246
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100626246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 395 aa AA seqDB search
MKWLGESKNMVVNGRRSGGKLSNDHQQNQPKLQHTGKDAVKAGKNAERRSSRCNGNSGFE
GQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFPH
NNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEH
VFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENM
LLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGE
EISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNRL
KKLGDSSKNSDSQSVSSNTDADTTQEKNNARSPYV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaagtggaggcaag
ttgtctaatgaccatcagcagaatcaaccaaaattgcagcacacgggaaaggacgccgtg
aaggctggcaaaaacgcagagaggaggtcgagcagatgtaatggtaattcaggattcgaa
ggacagagtcgatatgtaccatcttccgggatgtctgcaaaggagctctgtgagaatgat
gacctcgcaaccagtttggttcttgatccctacttaggtttccaaacacacaaaatgaat
actagcgcttttccttcgaggagctcaaggcatttttcaaaatctgacagttttcctcac
aacaaccccgtgagattccggcctattaaaggaaggcaagaagaactaaaggaagtaatt
gaacgttttaagaaagacgagcacttggagaaagccttcaaatgtttgacttcaggcgaa
tgggcacggcactattttctcaacaagaacaaaatgcaggagaaattattcaaggaacat
gtatttatttacttgcgaatgtttgcgactgacagtggatttgaaatattgccttgtaat
agatactcttcagaacaaaatggagccaaaatagttgcaacgaaagagtggaaacgaaat
gacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaacatg
ctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgtgct
cagctctggcttggtcctgctgcgtttataaaccatgattgcagacctaactgtaagttt
gtgtcaaccggtcgagatacagcgtgtgtgaaggctctgagagatattgaacctggagaa
gaaatttcttgttactatggagatgggttttttggagaaaataatgagttctgcgagtgt
tacacctgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcgcct
gctcctgttatcaatagcaaatacggactcagagaaacagataagcgtttaaataggctt
aaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacactgat
gcagataccactcaggaaaaaaacaatgcaaggtcaccatatgtttga

DBGET integrated database retrieval system