KEGG   Sus scrofa (pig): 100626328Help
Entry
100626328         CDS       T01009                                 

Definition
ubiquitin carboxyl-terminal hydrolase 17-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100626328
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100626328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 517 aa AA seqDB search
MEVASLGWGQERLPNIFPPKRTSPWSAAAVDLPWGPSGPEKPSPSSQALCNQQADAAPVA
AVGPVPTKGPLSWRPSVVGAGLQNLGNTCYVNAVLQCLTHTPPLAISLLNGQHQRACQKQ
PFCMLCAVRAHVTRALLHPGDVIQPRKDLVASFHRHRQEDAHEFLMFALDAMQRCPSEDT
LIQQIFGGCWRSQIQCLRCLGVSDTFDPYLDVTLDITAAQSVEQALRELVKAEKLDGENA
YHCGVCLRKGPATKRLTLHRASKVLILVLKRFTDVTGDKMDKKVRYPEHLDLQPYLSVQK
AGALDYELFAVLVHSGWTCHQGHYFCYIRAGNGWWYRMDDSKVTACDTASALSQSAYVLF
YIQRGELERATGGASADRAPRSPGADPIGRDAAVGEPRSPSSIRVSASEGPLAETDIQEI
TLEQWRRHQEHSRPKAEFNLRKVEPALPTNAVVIHRSKFGDGTGRKLPAQENCGVSTSTR
DAPPEGATNMGSIPCLEGRTKASKKKNKKKQRPLALQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcttctcttggctggggccaggagcgtctgcccaacatctttccaccaaaa
cgcacatctccgtggtcagctgcagctgttgatttgccttggggaccctctggacccgag
aaaccatcgccatcatcccaggcactttgcaaccagcaggctgatgcggctcctgtggcg
gcagtaggaccggtgcccacaaaggggcctctgagttggagaccatccgtggtgggtgct
gggcttcagaacctgggcaacacgtgctatgtgaacgcagtgctgcagtgtctgacacac
acgccccccctggccatctctctgctgaatgggcagcaccagagagcctgccagaagcag
cccttctgcatgctgtgtgctgtgcgagctcacgtgacccgagccctcctgcatcccgga
gatgtcatccagcctcggaaggacctggtcgccagcttccacagacacaggcaggaagat
gcccacgagttcctaatgttcgctctggatgccatgcagagatgtccctcggaagacacc
ctcatccagcaaatctttggagggtgctggagatctcagatccagtgtctccgctgtctt
ggtgtttcagacacttttgacccttatctggacgtcaccctggatatcacggcagctcag
agtgtggagcaagccctgagagagctggtgaaggctgaaaaactggacggggaaaatgcc
taccattgtggtgtttgtctcaggaagggacccgccaccaagaggctgactttgcacagg
gcctccaaggtcctgatccttgtgctgaagcggttcacggatgtcactggcgacaagatg
gacaagaaagtgcgataccctgagcacctggacctgcagccctacctgtctgtgcagaag
gccggagccctggactacgagctcttcgctgtgctggtgcactctgggtggacctgtcac
caaggacactacttctgctacatcagagcgggaaatggctggtggtacagaatggatgat
tcgaaggtcaccgcctgtgacactgcttctgccctgagccaaagcgcctatgtcctcttt
tacatccagaggggcgagctggaaagagccaccggtggagcgtcagcagacagggcacct
cggtctccgggagctgatcctataggcagggatgcagcggttggggagcccagaagcccc
tccagcatcagagtgtctgcatcggaggggcctctggcagaaactgacatccaggagatc
accttggagcagtggagacgccaccaggaacacagccgacctaaggctgaattcaacctc
aggaaagtagagcctgccctcccgaccaatgcagtcgtcatccacaggtcgaaattcgga
gatgggaccggaaggaaactgcccgcacaggaaaactgcggggtcagcacttcaaccagg
gacgccccacctgagggcgcaacgaacatggggagcatcccttgtctggaagggaggacc
aaggcctccaagaaaaagaacaagaagaagcagaggcctctggcactgcagtga

DBGET integrated database retrieval system