KEGG   Sus scrofa (pig): 100626434Help
Entry
100626434         CDS       T01009                                 

Gene name
ADI1
Definition
acireductone dioxygenase 1
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ssc  Sus scrofa (pig)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ssc00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 179 aa AA seqDB search
MVQAWYMDESADDPRLPHRTEPARPVGLEQLRRLGVLYWKLDADKYENDPELEKIRNERN
YSWMDIITICRDKLPNYEEKIKTFYEEHLHLDDEIRYILDGSGYFDVRDQDDRWIRIFME
KGDLITLPAGIYHRFTLDEQNYVKAMRLFVGDPVWTPYNRPADHLEARGQYLRFLAQST
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtacatggacgagtcggccgacgacccgcgactgccccaccgcacg
gagcccgcccgcccggtcggcctggagcagctgcgccggctcggcgtcctctactggaag
ctggatgctgacaaatatgagaatgatccagaattagagaaaatccgaaacgagagaaac
tactcctggatggacataattaccatatgcagagacaaactaccaaattacgaggagaag
attaagacattttacgaggagcacctgcacctggatgacgagatccgctacatcctggac
ggcagtggctacttcgacgtgagagaccaggacgaccggtggatccggatcttcatggag
aagggggacttgatcacccttcccgccggcatctaccaccgcttcacgctggacgagcag
aactacgtgaaggccatgcggctgttcgtgggcgaccccgtgtggacaccgtacaaccgg
ccagccgaccacctggaggcccgcgggcagtacctgcggttcctggcgcagtccacgtag

DBGET integrated database retrieval system