KEGG   Sus scrofa (pig): 100626923Help
Entry
100626923         CDS       T01009                                 

Gene name
KAT2B
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase KAT2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100626923 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100626923 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100626923 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    100626923 (KAT2B)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100626923 (KAT2B)
Transcription machinery [BR:ssc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100626923 (KAT2B)
Chromosome [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100626923 (KAT2B)
   HAT complexes
    PCAF complex
     100626923 (KAT2B)
    STAGA complex
     100626923 (KAT2B)
    TFTC complex
     100626923 (KAT2B)
    SAGA complex
     100626923 (KAT2B)
    SLIK complex
     100626923 (KAT2B)
    ADA-HAT complex
     100626923 (KAT2B)
    HAT-A2 complex
     100626923 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 832 aa AA seqDB search
MSEAGGAGPGGGGAGAGAGAGLGALPPPPPAPPPAPPXGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPPKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETAQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVISPPPVAGTISYNPHSSSHEQQNGGSTSPSCKGTSG
LEANPGEKRKMNDSHVLEEAKKPRVMGDIPLELIHEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLACFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPKDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggcggcggggcgggggccggggcgggggct
gggctcggggcgctacccccgccgccccccgcgccgccgcctgcgcccccgncaggctcc
ccttgcgccgccgccgccgggggctcgggtgcctgcggaccggcgacggcggtggcggcg
gcgggcacagccgagggaccgggaggcggcggctcggcccggatcgcggtgaagaaggcg
caactgcgctccgctccgcgggccaagaaactggagaaactcggagtgtactccgcctgc
aaggctgaggaatcttgtaaatgtaatggctggaagaaccccaacccttctcccactcca
cccagagccgatctgcagcaaataatcgtcagtctgaccgaatcctgccgcagttgtagc
catgccctagctgctcatgtttcccacctggagaatgtgtcagaggaagaaatgaacaga
ctcctggggatagtgttggatgtggaatatctctttacctgtgtccacaaggaggaagat
gcagacaccaaacaagtttacttctatctgttcaagctcttgagaaagtctattttacaa
agaggaaaacctgtggtcgagggctctttggagaagaaacccccatttgaaaaacctagt
atcgaacagggtgtgaataactttgtacagtacaaatttagtcacctgccacccaaagaa
aggcaaacaatagttgagttggcaaaaatgttcctaaatcgcatcaactattggcacctg
gaggcaccctctcaacgaagattgcgatctcccaatgatgacatttctggatacaaagag
aactatacaaggtggctgtgttactgcaacgtgccgcagttctgtgacagtctgcctcga
tacgagaccgcccaggtgttcgggagaaccctgctccgctccgtcttcaccgttatgagg
cgacagctcctggaacaggcgaggcaggagaaagacaaactgccacttgagaaacggact
ctaattctcacccatttccccaagtttctgtccatgttagaagaagaagtttatagtcaa
aactctcccatttgggatcaggattttctctcagcttcttccagaaccagccagttagga
atccaaacagttatcagtccacctcctgtggctgggacaatttcatacaatccgcactca
tcttcccatgaacagcagaatggagggagcaccagtccttcctgcaaaggtacttccggg
cttgaggcaaacccaggagaaaagaggaaaatgaacgactctcatgttttggaggaggcc
aagaaaccccgagtgatgggcgacattccactggaattaatccacgaggtcatgtccacc
atcacggatcctgcagccatgctcgggccagagaccaattttctgtcagcacattcagcc
cgggacgaggcggcaaggctggaggagcgcaggggtgtgattgaatttcatgtggtgggc
aattccctgaaccagaagcccaacaagaagattctgatgtggctggtgggtctgcagaac
gtgttctcccatcagctgccccggatgccaaaggagtacatcacacggctggtctttgac
ccgaaacacaaaaccctcgctttgattaaagatggacgtgttattggtggcatctgtttc
cgcatgttcccttcccaaggattcacagagattgttttctgtgctgtaacctcaaatgag
caagtcaagggctatggaacacatctgatgaaccatttgaaagaatatcacataaaacat
gacatcctgaacttcctcacatatgcagatgaatatgcaattggatatttcaagaagcag
ggtttctccaaagaaattaaaatccccaaaaccaaatatgttggctacatcaaggattat
gaaggagccactttaatgggatgtgagctaaatccacggatcccgtacacagaattttct
gtcatcattaagaagcagaaggagatcattaaaaagctgatagaaaggaaacaagcccag
attcggaaagtctaccctggacttgcctgttttaaagatggagttcggcagattccgata
gaaagcattcctggaattcgagagacaggctggaaaccaagtggaaaagagaaaagtaaa
gagcccaaagaccctgaccagctttacagcacactcaagagcatcctacagcaggtgaag
agccatcaaagcgcttggcccttcatggaacccgtgaagagaacagaagctccgggatat
tatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaagaatagg
tactacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaa
gagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaattcttc
ttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system