KEGG   Sus scrofa (pig): 100627038Help
Entry
100627038         CDS       T01009                                 

Gene name
UNC13A
Definition
(RefSeq) protein unc-13 homolog A isoform X1
  KO
K15293  
protein unc-13 A/B/C
Organism
ssc  Sus scrofa (pig)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100627038 (UNC13A)
Membrane trafficking [BR:ssc04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100627038 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 1730 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSELEDERDRDS
YHSCHSSVSYHKDSPRWDQDEDELDEELDEELDEELEDFLEEEEEELPEDEEELEEEEEV
PDDIRGYTQQEEVAVAEPKEFKRVSLPPAAPEKDKASAVPSGVPDVAKAAPEPALPEEVP
ATEQELEPEPPKAEESFRPREDEEIQEGQDSMSRAKANWLRAFNKVRLQLQEARGEGEMS
KSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEEL
KNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVT
KTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRT
KTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEV
RTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTD
VQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPG
VPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYR
NNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIF
NNCHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQ
FPQELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELP
AFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDV
FSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVP
CILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHI
EECVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLK
RVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFNA
AKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQ
SLRYALSLYTQATDLLIKTFVQTQTGQVHGGKGTRFTLSEDIYPEKGSGVEDPVGEVSVH
VELFTHPGTGEHKVTVKVVAANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNS
WAPKYNESFQFTLSADAGPECYELQVCVKDYCFAREDRTVGLAVLQLRELVQRGSAACWL
PLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSTEEGGAAPAP
NT seq 5193 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcctttgcgttggagtcaaaaaagccaagtttgatggtgcccaagagaaattc
aacacgtatgtgaccctgaaggtacagaatgtcaagagcacgaccatcgccgtgcggggc
agccagcccagctgggagcaggatttcatgttcgagattaaccgcctggatctggggctg
acagtggaggtgtggaacaagggtctcatctgggacacaatggtgggcaccgtgtggatt
cccctgaggaccatacgccagtccaatgaagagggccctggagaatggctgaccttggac
tctcaggtcatcatggcggacagtgagatctgtggcactaaggaccccactttccaccgc
atcctccttgacactcgctttgagctgcctttagatatccctgaggaggaggcacgctac
tgggccaagaagctggagcagctgaatgctatgcgggaccaggatgagtattcattccag
gatgaacaagacaagcctcttcctgtccccagcaaccagtgttgcaactggaattatttt
ggctggggtgaacagcagaacgatgaccctgacagtgcagtggatgatcgtgacagtgac
taccgcagtgagacaagcaacagcatcccaccaccctattatactacatcccagcccaat
gcctcggtccaccaatattctgtccgcccaccacccctgggttcccgggaatcctacagt
gactccatgcacagttatgaggagttttccgaacctcgtgccctcagccccacaggtagc
agccgttatgcctcctcaggagagctgagccaaggcagctcacagctgagtgaggacttt
gacccagacgagcagagcctgcagggctctgagctggaggatgagcgggaccgggactcc
taccactcctgccacagctcagtcagctaccacaaggactcgccgcgctgggaccaggat
gaggatgagctggatgaggagctggatgaggagctggatgaggagctggaggacttcctg
gaagaggaggaggaggagctgcctgaggatgaggaagaactagaggaagaggaggaggtg
ccagatgacatccgtggctacacccagcaggaggaggtggctgtggctgagcccaaagaa
ttcaagcgtgtcagcctcccacccgctgctcctgagaaggacaaggcttcagctgtaccc
tcgggggtccctgacgtggccaaggcagcccctgagccagccttgcctgaggaggtgcct
gcaactgagcaggagcttgagccagagccccccaaggctgaggagagtttcaggccacga
gaagatgaggaaatccaggagggtcaggattccatgtctagggccaaggccaactggcta
cgagccttcaacaaagtgcgactgcagctgcaggaggcccggggagaaggagagatgtcc
aaatccttgtggttcaaaggcggccctggcggtggtctcatcatcattgacagcatgcca
gacatccgcaagaggaagcctatcccactagtgagcgacctggctatgtccttggtccag
tccagaaaagcaggcatcacctctgccttggcatccagcactttaaacaacgaagagctg
aaaaaccacgtttacaagaagaccctgcaagccttaatctaccccatctcgtgtacgact
ccgcacaacttcgaggtgtggacggccaccacacccacctactgctacgagtgcgagggg
ctgctctggggcatcgcgcggcagggcatgcgctgtaccgagtgcggcgttaagtgccac
gagaagtgccaggacctgctcaatgcagactgtctgcagcgggcagcggagaagagctcc
aagcacggagcggaggaccggacacagaacatcatcatggtgctcaaagaccgcatgaag
atccgggagcgcaacaagcccgagatcttcgagctcatccaggagatctttgcggtgacc
aagactgcgcacacgcagcagatgaaggcagtcaagcagagcgtcctggacggcacatcc
aagtggtcggccaagatcagcatcaccgtggtctgtgcccagggcttgcaggcaaaggac
aagacaggatccagtgacccctatgtcaccgtccaggttgggaagaccaagaaacggaca
aaaaccatctatggaaacctgaaccccgtgtgggaggagaacttccactttgaatgtcac
aactcctccgaccgaatcaaggtgcgcgtctgggatgaggatgatgacatcaaatctcga
gtgaagcagcggttcaagagggaatccgatgactttctggggcagacgatcatcgaggtg
cggacactcagtggcgagatggacgtgtggtacaacctggacaaacggactgacaaatct
gctgtgtcgggtgccatccggctacacatcagtgtggaaattaaaggcgaggagaaggtg
gccccctaccatgtccagtatacctgtctgcacgagaacctgttccactttgtgacagac
gtgcagaacaatggggtcgtgaagatcccagacgccaagggtgatgacgcctggaaggtt
tactatgatgagacagcccaggagattgtagatgaatttgccatgcgctatggtgttgag
tccatctaccaagctatgacccactttgcctgcctctcctccaagtacatgtgtcccggg
gtgcctgcggtcatgagcaccctgcttgccaacatcaatgcctactacgcacacaccacc
gcctccaccaacgtgtctgcctccgaccgcttcgccgcctccaactttgggaaagaacgc
tttgtgaagctcctggaccagctgcataactccctaaggatcgacctctccatgtatcgg
aataactttccagccagcagtccagagagactccaggacctcaaatccactgtggacctt
ctcaccagcatcaccttctttcggatgaaggtacaagaactccagagccctccccgagcc
agccaggtggtgaaggactgtgtgaaagcctgcctcaactctacttatgaatacatcttc
aacaactgtcatgaactctatagtcgagagtaccagacagacccggccaagaagggggaa
gttcctccagaagaacagggccccagcatcaagaacctcgacttctggtccaagctgatc
actctcatcgtgtccatcattgaggaagataagaattcctacactccctgcctcaaccag
tttccccaggaattgaacgtgggtaaaatcagtgccgaagtgatgtggaatctgtttgcc
caggacatgaagtatgccatggaggagcatgataagcatcgtctatgcaagagtgccgac
tacatgaacctccacttcaaggtcaaatggctctacaatgagtatgtggcagagcttcct
gcctttaaggaccgagtgcctgagtaccctgcgtggtttgagcccttcgtcatccagtgg
ctagatgagaatgaggaagtgtcccgtgatttcctgcatggagccctggagcgagacaag
aaggatgggttccaacaaacttcagagcatgccctattctcctgctccgtggtggacgtc
ttctcacagctcaaccagagctttgagatcatcaagaaactcgagtgtcctgacccccag
atcgtggggcactacatgaggcgctttgccaagaccatcagtaatgtgctcctccagtat
gcggacatcatctccaaggactttgcctcctactgctccaaggagaaggagaaagtgccc
tgcattctcatgaacaacactcagcagcttcgagttcagctagagaagatgttcgaagct
atgggagggaaggagctggatgctgaggccagtgacatcttgaaagagctgcaggtgaaa
ctcaacaatgtcttggatgagctcagccgggtgtttgctacaagcttccagccacacatt
gaggagtgtgtcaagcagatgggtgacatccttagccaggtgaaaggcacaggcaatgtg
ccagccagtgcctgcagcagtgtggcccaagatgccgacaatgtgctacaacccatcatg
gacctgctggacagcaacttgactctctttgccaaaatctgtgagaagacggtgctgaag
cgagtgctgaaggagttatggaagctggtcatgaacaccatggagaagaccatcgtcctg
ccgcccctcaccgaccaaacgatgatcggcaccctcttgagaaaacatggcaagggatta
gaaaagggcagggtgaaattgccaagccactcagatggaactcagatgatcttcaatgca
gccaaggagctgggtcagctgtctaaactcaaggaccatatggtaagagaagaagccaag
agcttgaccccgaagcaatgtgcagttgtcgagctggccctggacactatcaagcaatac
ttccatgcgggtggtgtgggtctcaagaaaactttcctggagaagagtccagacctgcag
tccctgcgctatgccctgtccctctacactcaggccaccgacctgcttatcaagacattc
gtgcagacgcagaccggccaggtccatggtggaaaagggactaggtttacccttagtgaa
gacatttatcctgagaagggctcgggtgtggaagatcctgtgggtgaagtctccgtccat
gttgagctcttcactcatccaggaactggggaacacaaggtcacagtgaaagtggtggct
gccaatgacctgaagtggcagacttctggcattttccggccattcatcgaggtcaacatc
attgggccccagctcagcgacaagaaacgcaaatttgcgaccaaatccaagaacaacagc
tgggcccctaagtacaatgagagcttccagttcacgctgagtgccgacgcgggccccgag
tgctacgagctgcaggtgtgcgtcaaggactactgcttcgcgcgtgaggaccgcacggtg
gggctggccgtgctgcagctgcgcgagctggtccagcgagggagcgccgcctgctggctg
ccgctcggccgccgcatccacatggacgacacgggcctcacggtgctgcgcatcctgtcg
caacgcagcaacgacgaagtggccaaggagttcgtcaagctcaagtcggacacgcgctcc
accgaggaaggcggggccgcgcctgccccctag

DBGET integrated database retrieval system