KEGG   Sus scrofa (pig): 100627040Help
Entry
100627040         CDS       T01009                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 325 aa AA seqDB search
MRCLVVLLAVLALSQGSGITRVPLRKGKSLRKELKERGLLEDFLQKQPYALSSKYSSFGE
VASEPLTNYLDSWHVGRIYIGTPPQEFTVVFDTGSSELWVPSVYCKSDACQNHHRFNPSK
SSTFQNLDKPLSIQYGTGSIQGFLGYDTVMVSGASGQPALTVGLSTQEPSDIFTYSEFDG
ILGLGYPELASEYTVPDLFAVYMSRNDEGSMLTLGAIDPSYYTGSLHWVPVTMQLYWQFT
VDSVTINGVVVACNGGCQAILDTGTSMLAGPSSDILKIQMDQGFCTSGFQGDSKSQHWIL
GVVFIQEYYSVFDRANNRVGLAKAI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgtctcgtggtgctccttgcggtcctcgcgctctcccagggcagtgggatcacc
agggtccctctgcgcaaaggcaagtctctgagaaaggagctaaaggagcgtgggctcctg
gaggactttctgcagaaacagccgtatgccctcagcagcaagtactccagcttcggggag
gtggccagtgagcccctgaccaactacctcgattcctggcacgtggggagaatctacatc
gggaccccaccccaggagttcaccgtggtgtttgacaccggctcctccgaactctgggtg
ccctctgtctactgcaagagcgatgcctgccaaaaccaccaccgcttcaacccgagcaag
tcatccaccttccagaacctggacaagcccctgtccatccagtacggcacgggcagcatt
cagggctttctgggctacgacaccgtcatggtgagtggggcttcaggccagccagcactc
accgtgggcctgagcacccaggagcccagtgacatcttcacctactcggagtttgacggc
atcctggggctgggctaccccgagctcgcctctgagtacacggtgcctgacctgttcgcg
gtttacatgagcaggaatgacgaggggagcatgctcacgctgggggccattgacccgtcc
tactacacgggatccctgcactgggtgcccgtgaccatgcagttgtactggcagttcacc
gtggacagtgtcaccatcaatggtgtggtggtggcctgtaatggtggctgtcaggccatc
ctggacacgggcacctccatgctggctgggcccagcagtgacatcctcaaaatccagatg
gaccagggcttctgcaccagtggcttccagggtgacagtaagtctcagcactggatcctg
ggagttgtcttcatccaggagtattacagcgtctttgacagagccaacaaccgcgtgggg
ctggccaaggccatctga

DBGET integrated database retrieval system