KEGG   Sus scrofa (pig): 100627093Help
Entry
100627093         CDS       T01009                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
ssc  Sus scrofa (pig)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100627093
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100627093
Cytochrome P450 [BR:ssc00199]
 Cytochrome P450, animal type
  CYP4 family
   100627093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 505 aa AA seqDB search
MESSWLETHWARPLHLALVFCLALGLLQAVKLYLQRQRLLRDLRPFPSPPSHWFYGHQKI
IQNGGMETLGEITDKYPRAFPFWLGPFQAFFFIYDPDYAKTLLSRPDPKSNFLYKFMDPV
VGKGLLNLNGPKWFQHRRLLTPGLHLNALKSHVEIMAHSVNTMLGKWERICGTEDTLLEI
SAHVTLLTLDIIMKCVFGLETNCQINSTYDHYIKAANESSNIIFYRLYNFLYHHDVIFKF
SPKGHRLWQLRKILHPYTEKIIQAGKNSRMNENQQGNTQKRKYQNVLDIALSALAENGDS
FSDTDLWSEVNTFLLAGHETMTGGLTWLLYHLALYPEHQERCREEIRSILGDGSSITWGQ
LGEMSYTTMCIKESLRLAPPVLSFSRELSKPITFSDGRSLPAGITVVCSIWGLHHNPAIW
ENPQEFDPSRFAPGSARHSHAFMPFSGGSRNCIGKQFAMNEMKVAVALTLLRFELAPDPS
RKPTVIPEVVLHSKNGIHLKLRKLP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcctggctggagacgcactgggcgaggcccctccacctggcgctggtgttc
tgcttggccctggggctgctgcaggctgtcaagctctacctgcagaggcagcggctgctc
cgagacctgcgccccttcccctcgcccccgagccactggttctacgggcaccagaagata
attcagaatggtggaatggagacgctcggggagattacagacaaatacccgcgtgccttt
cctttctggcttggaccctttcaggcgtttttctttatctatgacccagactatgcaaag
actcttctgagcagaccagatcccaagtccaacttcctgtacaagttcatggatccagtc
gttggaaaaggactcttgaatctgaatggacctaagtggttccagcatcgtcgcctactg
acgcccggactccatttgaacgccttgaaatcgcatgtggagataatggcccattctgtg
aacacaatgctgggtaaatgggagaggatttgtggcactgaggacacgcttctggagatc
tctgcgcacgtcaccttgctgaccctggacataatcatgaaatgcgttttcggcttggaa
accaactgccagataaacagcacctatgatcattacataaaagcagcaaatgaaagcagc
aatataattttttaccgcttgtacaatttcttatatcaccatgacgtcattttcaagttc
agcccgaagggccaccgcttatggcagttaaggaagatactgcatccctacacagaaaag
ataatccaggctggaaagaattcccgcatgaatgagaatcaacagggtaacactcagaag
aggaagtaccagaatgttcttgatattgccctttctgctctggctgaaaatggtgacagc
ttctcagatactgacctatggtctgaggtaaacacattcctgttggcagggcatgaaacc
atgacaggcggccttacctggctcctctaccacctggctctgtaccctgagcatcaggag
agatgccgggaagagatcaggagcatcctgggtgacgggtcttccatcacctggggccag
ctgggtgagatgtcatacaccacgatgtgcattaaggagtccctccgcttggcacctcca
gtcctctccttttccagagaactcagcaagcccattaccttctcagatggacgctccttg
cctgcaggaattactgtggtttgcagtatctgggggctccaccacaaccctgccatctgg
gaaaacccacaggagtttgacccatcccggtttgcaccgggttctgctcgacacagccat
gccttcatgcccttctcaggaggatccaggaactgcattgggaagcagtttgccatgaac
gagatgaaggtggctgtggccctgactctgctccgctttgagctggcaccagatccctcc
aggaagcccactgtcattccagaagttgtgttgcactccaaaaatgggatccacctgaag
ctccgcaagctcccgtaa

DBGET integrated database retrieval system