KEGG   Sus scrofa (pig): 100627239Help
Entry
100627239         CDS       T01009                                 

Gene name
POP7
Definition
processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
ssc  Sus scrofa (pig)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100627239 (POP7)
   03008 Ribosome biogenesis in eukaryotes
    100627239 (POP7)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     100627239 (POP7)
Ribosome biogenesis [BR:ssc03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     100627239 (POP7)
Transfer RNA biogenesis [BR:ssc03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    100627239 (POP7)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    100627239 (POP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 140 aa AA seqDB search
MAENREPRGAVEAELDPVEYTLRKRLPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGV
RGQNACTEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP
LTRIRNNSAIHIRVFRVTPK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaccgagaaccccgcggggccgtcgaggccgagctggacccggtggaatac
accctgcggaagcggcttccccaccgcctgccccggaggcccaatgacatttatgtcaac
atgaagactgactttaaggcccagttggcccgctgccagaagctgctggacggaggggta
aggggtcagaatgcatgcactgagatctacattcatggcttgggcctggccatcaaccgc
gccatcaacattgccctgcagctgcaggctggcagcttcgggtccttgcaggtagctgcc
aatacctccaccgtggagcttgtcgatgagctggaaccagagactgatacacgagagcca
ctgacgcgtatccgcaacaactcagccatccacatccgtgtcttcagggtcacacctaag
taa

DBGET integrated database retrieval system