KEGG   Sus scrofa (pig): 100627643Help
Entry
100627643         CDS       T01009                                 

Gene name
GEMIN7
Definition
(RefSeq) gem-associated protein 7
  KO
K13135  
gem associated protein 7
Organism
ssc  Sus scrofa (pig)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100627643 (GEMIN7)
Spliceosome [BR:ssc03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100627643 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
6
AA seq 131 aa AA seqDB search
MQTPLAIPVPVLRLPRGPDGLSRGFAPDARRGLLKPQVPETPESPVVQESQESQEQQARA
ALRERYLRSLLAMVGRQVSFTLHEGVQVTAHFGATDLDVANFYVSQLQTPIGVQAEALLR
CSDIIAYAFKL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgccgctggccatccccgtgcctgtgctccggctcccccggggcccggatggc
ctgagccgaggctttgcccccgacgctcgcaggggcctcctgaaaccacaggttcctgaa
actccggagtctcctgtagttcaagaatctcaggaatcccaggaacagcaggcccgagcc
gccctgcgggagcgctacctccgcagcctgctggccatggtgggtcgccaggtgagcttc
acgctgcacgagggcgtgcaggtgactgcccacttcggagctacggacctggacgtggcc
aacttctatgtgtcgcagctgcagaccccgatcggtgtacaggctgaggcgctgctccgg
tgtagtgacattatcgcatacgccttcaagctgtga

DBGET integrated database retrieval system