KEGG   Sus scrofa (pig): 100627707Help
Entry
100627707         CDS       T01009                                 

Gene name
DHCR7
Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ssc  Sus scrofa (pig)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100627707 (DHCR7)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100627707 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 475 aa AA seqDB search
MAAKSQPGTPKTKSLGSVSNGSAATQGQWGRAWEVDWFSLASVIFLLLCAPFIVYYFIMA
CDQYGCSLTAPLGDIATGRARLSDIWAKTPPVTRTAAQLYTAWVTFQVLLYMLLPDFCHK
FLPGYVGGVQEGAVTPAGVVNKYQINGLQAWLITHLLWFANSHVLSWFSPTIIFDNWIPL
LWCANILGYAVSTFAMIKGYCFPTDARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQQQLYGHVTNSMVLVNVLQAIYVLDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPYAVGVLLLGLLGYYIFRMANHQKDL
FRRTDGRCLIWGRKPQVIECSYTSADGQKHHSKLLVSGFWGVARHFNYTGDLLGSLAYCL
ACGGGHLLPYFYIIYMGILLTHRCLRDEHRCANKYGRDWERYTATVPYRLLPGVF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaatcccagcccggcactcctaaaaccaagagtctcggcagtgtcagcaat
ggcagtgctgccactcaggggcagtggggccgtgcctgggaggtggactggttttccctg
gcgagcgtcatcttcctgctgctgtgcgcccccttcatcgtctactacttcatcatggcc
tgcgaccagtacggctgctccctgaccgcccccctgggcgacatcgccaccgggcgggcg
cgactctccgacatctgggccaagacgccacctgtgacgaggaccgcggcccagctctac
acggcgtgggtcacattccaggtgcttctgtacatgctgctccctgacttctgccataag
tttctgccgggctacgtgggcggcgtgcaggagggcgccgtgactcccgcaggagtggtc
aacaagtatcagatcaacggcctgcaggcctggctcatcacccacctgctgtggttcgct
aactcccacgtcctctcctggttctcccccaccatcatcttcgacaactggatcccgctg
ctgtggtgcgccaacatcctgggctacgccgtctccaccttcgccatgatcaagggctac
tgcttccccaccgatgcccgagactgcaagttcacgggcaacttcttttacaactacatg
atgggtattgagttcaacccccgaatcgggaagtggtttgacttcaagctcttcttcaac
gggcgccccgggatcgtcgcctggaccctcatcaacctgtccttcgcggccaagcagcag
cagctctacggccacgtcaccaactccatggtcttggtcaacgtcctgcaggccatctac
gtgctggacttcttctggaacgagacctggtacctgaaaaccattgacatctgccacgac
cacttcgggtggtacctgggctggggggactgcgtctggctgccgtacctctatacgctg
cagggtctgtacctggtttaccaccccgtgcagctgtccaccccctacgccgtgggcgtc
ctgctgctgggcctgctgggctactacatcttccggatggccaaccatcagaaggacctg
tttcggcgcacggacgggcgctgcctgatctggggccggaagccccaggtcatcgagtgt
tcctacacgtcggccgacggccagaagcaccacagcaagctgctggtgtccggcttctgg
ggcgtggcccgccacttcaactacacgggcgacctgctgggcagcctggcgtactgcctg
gcctgtggcggcggccacctgctgccctacttctacatcatctacatgggcatcctgctg
acccaccgctgcctgcgggacgaacaccgctgtgccaacaagtacggccgggactgggag
cgctacacggccaccgtgccttaccgcctgctgcccggcgtcttctga

DBGET integrated database retrieval system