KEGG   Sus scrofa (pig): 100627718Help
Entry
100627718         CDS       T01009                                 

Gene name
USP31
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 31
  KO
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100627718 (USP31)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100627718 (USP31)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100627718 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 1136 aa AA seqDB search
MDLGKRPSIPDLVPPDPAGLTSLSSEGSTAGGRAIRVRAVLLLVQREHPAAPAAKALVSF
PLRRRTRGSPEPATIRQRPLPARGRFASQPGLVRGDILIPALSQSLHRRISEDRDPPRGV
HHPALAVRFPGRLDLAHTRHGFLWASSSGTRPEPLVIASGWKEGSVPRGGLRSCFPPGPA
AAPTPPPCPPPPASPAPPASAAEPVPGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALG
QYRAGRPEPSPDPEQPAGRGSQGQGEVTEQLAHLVRALWTLEYTPQHSRDFKVRLGHPPA
RSILPRCGRGRRTESTGCLEKGVWAALPGRWRGFIAFGEMFSAMVGCPLWPGAAFDWVFL
LIPSHVVLGEIWGCTTLWPRREARRRRRCLEKHLASSGTYRSRAPCFQLAPDDAWRCPHC
KQLQQGSITLSLWTLPDVLIIHLKRFRQEGDKRTKLQNMVKFPLTGLDMTPHVVKRSQSS
WSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGLWYCFDDS
DVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKQASVT
SAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSARSSVTSPLAVNENC
MRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAVDDKVSISCFGSLRNLASLY
QDSSDSRREHKAVGRAPLAVMEGVFKDEADARRLNPGVADTQSKSPAQGDPLPPVSVPFD
NNNQIAYVDQSDSVDSSPVKEVKPPGHAGSLAKKPESTAKRSPSSKGASEPERSLRKGRP
ALASQESSLSSPSPSSPGPVKVSVKPSRSRSKAESSSRASGRHASPAPTPKKDSSPKSQA
SASSPSLLKQKSASSLAYPASSASPKKASGPAPRGPLPPGKSRTSDRSLSREGSRQSLAS
DRAGVPASSKPSSPRGSQARAGDGRGDGRHVRSSSMASLRSPSVSGKAGLKRDSKSEDKG
LSFFKSALRQKETRRSTDLGKTSLLSKKAGGRGAAPDDKADRGSPKPKATAGAQEQPAPR
DPASAKHSLLSARKAKSSQLDPGAPASPSCRQSAETASKKLPSSMPTSARPSPKPQ
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atggacttaggaaagcgtcccagcatcccagacctggtgccacccgacccggctgggctc
acctcactcagttccgaagggtccaccgctggcgggcgagcgatccgcgtccgcgccgtt
ctgctgctggtacagcgcgagcatcccgcagccccagcggccaaggctcttgtgtctttc
cccctgcggcggaggacgcgtggcagccccgagccagccacgattcggcagcgccccctg
ccagccagaggccgctttgcgtctcagccggggctggtaaggggcgacatcctgatccct
gcactttcccaaagcctccaccgtcgaatcagcgaagaccgagacccaccccggggcgtc
caccaccctgcgctagccgtgcgcttccctgggcgcctggaccttgcccacactagacat
ggcttcctctgggcttcaagcagcggaacgcgcccggagccactagtcatcgcgtccggc
tggaaagaaggctccgttccccgcggcggcctccgcagctgcttcccgccggggccggcc
gccgcgcccacgccgccgccgtgcccgccgccgcccgcctcgcccgcaccgcccgccagc
gccgcggagccggtgcccggggtggcggggctccggaaccacggcaacacgtgcttcatg
aacgccacgctgcagtgtctcagcaacaccgagctcttcgccgagtacctggcgctcggc
cagtaccgggcggggcggcccgagccctcgcctgaccccgagcagcccgcgggccgcggc
tcgcagggccagggcgaggtcaccgagcagctggcgcacctggtgcgggccctgtggacc
ctggagtacaccccacagcacagccgcgacttcaaggtgaggcttgggcacccgcctgcc
cggagcatccttccccgctgtggtcgcggccggcggactgaaagcactggttgcctggag
aaaggggtgtgggccgcgctgccaggcagatggcgcggattcattgcttttggggagatg
ttttcagccatggtggggtgcccgctctggccaggcgccgctttcgattgggttttcctg
ttgatcccgtcacacgttgtgctgggagagatttggggttgtaccaccctctggccacga
cgtgaggcccgccgtcgtcgtcgttgcctggaaaagcatcttgcctcgagtggcacttac
cgaagtcgtgctccttgctttcagcttgccccagacgacgcctggcgttgcccacactgt
aagcagctgcagcaggggagcattacgttaagcctctggactctgcccgatgtgctgatt
atacatctgaagagatttcgacaggaaggagacaagcgtacaaaacttcagaacatggtc
aagttcccattgactggcctggacatgacacctcacgtggttaagaggagccagagcagc
tggagtttgccatcccattggtctccgtggcgacggccctacggactcgggagggaccct
gaggactacatctacgacctgtatgcggtgtgcaaccatcacggcaccatgcaagggggg
cactacacagcctactgcaagaactctgtggacggcctctggtactgcttcgacgacagc
gacgtgcagcagctgtcggaagacgaggtctgcacgcagacggcctacatcctcttctac
cagaggcggacggccataccgtcgtggtcggccaacagctcggtggcaggctccacaagc
tcctccctgtgcgaacactgggtgagccgactcccggggagcaagcaagccagcgtgacc
tctgcagcttcctccagacgcacctccctggcctcgctgtccgagtccgtggagatgact
ggggaaaggagcgaggacgatggaggtttctcgactcgaccattcgtgagaagtgtccag
cgccagagcttgtcagcccgatcctcggtcaccagccccttggctgtcaacgaaaactgc
atgaggccctcctggtccctgtctgctaagctgcagatgcgctccaattccccctcccgc
ttctcgggggactcccccattcacagctccgcctccaccttggagaagatcggggaggcg
gtggacgacaaggtctccatctcttgcttcggcagcttgaggaacctcgccagcctttac
caggactccagcgacagccggcgggagcacaaggccgtggggcgggcccctctggcggtc
atggagggtgtcttcaaagacgaggcggacgcccgcaggttgaacccgggggtggcagac
acccagagcaagagcccagcacaaggggatcccctgccccccgtctctgttccgtttgat
aacaataaccagattgcttatgtggatcagagcgattcagtagacagctctccagtcaaa
gaggtgaaacccccaggccacgccggctccctggcaaagaaacccgagagcacagccaag
cgatcccccagctccaaaggcgcttctgagccggagagaagcttgcggaaggggagacct
gccctggccagtcaggaatcctctctttccagtccgtccccttcgtcccctggtcccgtc
aaggtttccgtgaagccctcccgctcccggagcaaagcagagtcttcctcccgggccagc
gggcggcacgcctcccccgcccccacccccaaaaaggactcgtcccccaaatcccaggcc
tccgcgtcgtcgccctccctcctcaagcagaagtcggcctcttccctagcgtaccctgct
tcctcggcgtcccccaaaaaggcctcgggccctgccccgcggggccccctccctcccggc
aagagcaggacctcagaccggagcctgagcagagagggctccagacagagcctggcgtcc
gacagagccggcgtccccgccagctccaaacccagctccccgcgagggagccaggcccgg
gcgggcgacggccgcggggacggccggcacgtgcgcagctcgtccatggccagcctgcgc
tcgcccagcgtgagcgggaaggctggcctgaagagggacagcaagtcggaggacaagggg
ctgtccttcttcaagtcagccttgcggcagaaggagacccggcgctccacggaccttggc
aagacaagcctgctctccaagaaggcgggcggccggggcgcggcgcccgacgacaaggcc
gacagaggctccccgaagccgaaggccaccgcgggcgcgcaagagcagcccgcccccagg
gaccccgcttctgcgaaacactcgctgctgtccgcccgcaaagccaagtcttcccagcta
gatcccggagcgcccgcatctcccagttgcaggcagtctgctgagacggcctccaaaaag
ttaccttctagcatgccaacctctgcacggccttctccgaaacctcagtga

DBGET integrated database retrieval system