KEGG   Sus scrofa (pig): 100627842Help
Entry
100627842         CDS       T01009                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGQGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVGGVYYNLDSKLRAPEVLGNEDSVRAFLAAALAQGLCEVLLVVTKEVEE
KGSWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccaggagctcagccaagcccaccctccgtgtaccacgaacggcaacgc
ctggaactctgtgctgtccacgccctcaacaacgtcctgcagcagcagctcttcagccag
gaggctgccgatgagatctgcaagaggttggccccagattcccggctgaacccccatcgc
agcctcctgggcaccggaaactatgacgtcaacgtgatcatggccgccctgcaggggcag
ggcctggccgccgtgtggtgggacagaaggaggcccctgtcccagctggcgctgccgcag
gtgctggggctgatcctgaacctgccctcgcccgtgtcgctggggctgctgtccctgcca
ctgcgccggcggcactgggtggccctgcgccaggtgggcggcgtctactacaatctggat
tccaagctgcgggcgcccgaggtcctggggaacgaggacagcgtcagggccttcctggcg
gccgcgctggctcagggcctgtgcgaggtgctgctggtggtgaccaaggaggtggaggag
aagggctcctggctgcggacagactga

DBGET integrated database retrieval system