KEGG   Sus scrofa (pig): 100628097Help
Entry
100628097         CDS       T01009                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100628097 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    100628097 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100628097 (CLOCK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100628097 (CLOCK)
Transcription factors [BR:ssc03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100628097 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 407 aa AA seqDB search
MLFTVSCSKMSSLVDRDDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSVFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGMTPRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKVEVVC
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgcagtaaaatgagctcacttgttgacagagatgatggtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcagtttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctacagaagagcattgatttt
ttacgaaaacataaagagatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgctagaggctcttgatggt
ttttttttagcaattatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtgtatttaattttatcccagag
ggcgaacattcagaggtttataaaatactctctacccatcttctggaaagtgactcctta
acccctgagtatttaaaatcaaaaaatcagttagaattttgttgtcatatgcttcgagga
acaatagacccaaaggaaccatctacttatgaatatgtgaaatttataggaaatttcaaa
tctttaaacagtgtatccacctcagcacacaatggttttgaaggaatgacaccacgcaca
cacaggccttcttatgaagatagagtttgttttgtagctactgtcagattagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacctaatgaagagtttacatctagacat
agtttagaatggaagtttctatttctggatcacagggccccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattattatcatgtggatgacctagaaaac
ctggcaaaatgtcatgagcacttaatgcagtacgggaaaggcaaatcatgttattatagg
ttcctgactaaaggacaacaatggatttggcttcagactcactattatatcacttatcat
cagtggaattcaaggccagagtttattgtttgtactcacaccgtagtaagttatgcggaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttccggagacagctgct
gacaaagtagaagtagtctgttag

DBGET integrated database retrieval system