KEGG   Sus scrofa (pig): 100628105Help
Entry
100628105         CDS       T01009                                 

Gene name
USP25
Definition
ubiquitin specific peptidase 25
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Brite
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100628105 (USP25)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100628105 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 1144 aa AA seqDB search
MELQKQAWAGGVGLAVTESSELVLVLYILLFSCRKHQQTFLNQLREITGINDAQILQQAL
KDSNGNLELAVAFLTAKNAKTPQQEETAYYQTALPGNDRYISVGSQADTNVIDLTGDDKD
DLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYD
RKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLP
FMRELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQM
KAEEETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAA
MIEGEIESLHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLY
LDRYMHRNREITRIKREEIKRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFAS
SKPVCTSPVDDIDASSPSSGSIPSQTLPSTTDQQGAPSSELPSTSPASIAAISSRSVIHK
PFTQSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELM
YSDKSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRENRWMKYNDIAVTKSSWEELVRDS
FGGYRNASAYCLMYINDKPQFLIQEEFNKETGQALVGIETLPPDLRDFVEEDNQRFEKEL
EEWDAQLAQKALQEKLLASQKLRESESSMTTAQAGEPEYLEQPSRSDFSKHLKEETIRII
TKASHEHEDKSPETVLQSKPENTTSQPPSNQQVVEVAIPHVGKFMIESKEGGYDDEVMMT
PNMQGIIMAIGKARNVYDRCGPEAGFFKAIKLEYSRLVKLAQEDTPPETDYRLHHVVVYF
IQNQAPKKIIEKTLLEQFADRNLSFDERCHNIMKVAQAKIEMIKPEEVNLEEYEEWHQDY
RKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKELLSKGPHRGHDEELISHYRREC
LLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCS
YLGQEMESNLQEKLTDFLPKLLDCSTEIKGFHEPPKLPPYSTHELCERFTRIMLSLSRTP
ADGR
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggagctacagaagcaggcttgggctggaggtgtggggcttgctgtcactgagtcctct
gagctggtcttggtattgtatatcttgctcttcagttgtaggaagcaccagcagacgttt
ttgaatcagctgagagaaattactggcattaatgatgcccagatactacagcaagccttg
aaggatagtaatggaaacttggagctagcggtggctttccttactgcgaagaatgccaag
accccgcagcaggaggagacggcttactaccagacagcgcttcctggcaatgatcggtac
atcagtgtgggaagccaagcagatacgaatgtgattgatctcactggagatgataaagat
gatcttcagagagcaattgccttgagtttggcggaatcaaacagggcattcagggagact
ggaataactgatgaggagcaagccattagcagagttcttgaagccagcatagcagaaaac
aaagcatgtttgaagaggacacctactgaagtttggagagattctcgaaacccttatgat
agaaaaaggcaggacaaagctcctgttggactaaagaatgttggcaatacttgctggttt
agtgctgttattcagtcgttattcaatcttttggaatttagaagattagttctgaattac
aagcctccatcaaatgctcaagatttaccccgaaaccaaaaggagcatcggaatttgcct
tttatgcgtgagcttcggtatctgtttgcacttcttgttggtactaagaggaaatatgtt
gatccatcaagagcagttgaaattctcaaggatgctttcaaatcaaatgactcccagcag
caagacgtgagtgagtttacacacaaattattagattggttagaagatgccttccaaatg
aaagctgaagaagagacggatgaagagaagccaaagaaccccatggtagagttgttctat
ggaagattcctggctgtgggagtgcttgaaggtaaaaaatttgaaaatactgaaatgttt
ggtcaatacccacttcaagtaaatggattcaaagatctacatgagtgcctagaagctgct
atgattgaaggagaaattgagtctttacattcagaaaattcaggaaaatccgggcaagag
cattggtttactgaactaccgcctgtgttaacatttgagttgtcaagatttgaatttaat
caggcattgggaagaccggaaaaaattcacaacaaattagaatttcctcaagttttatat
ctggacagatacatgcatagaaatagagaaataacaagaattaagagggaagaaatcaaa
agactaaaagattacctcacagtattacaacaaagactagaaaggtatttaagctatggt
tcaggtcccaaacgattccccttggtagatgttctgcagtatgccttggaatttgcctca
agtaaacccgtttgcacttctcctgttgatgatattgacgctagttccccatctagtggt
tccataccatcacagacgttaccaagcacaacagatcagcagggagctccttcttcagag
ctgccaagcacatcgcctgcatcgatagctgccatttcatcgagatcagtaatacataaa
ccattcactcagtctcggatacctccagacttgcccatgcatccagcaccaaggcatata
acagaagaagaactctctgtgctagaaagctgtttacatcgctggaggacagaaatagaa
aatgacaccagagatttgcaggaaagcatatccagaatccatcgcacaattgaactaatg
tactctgacaaatctatgatacaggttccttatcgtttacatgctgttttagttcatgaa
ggccaagctaatgccgggcactactgggcatacatttttgatcatcgtgaaaacaggtgg
atgaagtacaatgatattgctgtaacaaaatcatcatgggaagagctagtgagggattcc
tttggtggttatagaaatgccagtgcatactgtttaatgtatataaatgataagccgcaa
ttcttaatacaagaggagtttaataaagaaactgggcaggctcttgttggaatagaaaca
ctaccaccggacttaagagattttgttgaggaagacaaccaacgatttgagaaagaacta
gaagaatgggacgcacagcttgcccagaaagctttgcaggaaaaacttttagcatctcag
aaattgagagagtcagagtcttctatgacaacagcacaagcaggagaaccagaatatcta
gagcagccgtcaagaagtgatttctcaaagcacttgaaagaagaaactattcgaataatt
accaaggcatcacatgagcatgaagataaaagtcctgaaacagttttgcagtcgaaacct
gaaaataccacaagtcaaccaccttccaaccagcaagttgtagaggtggcgattcctcat
gtagggaaatttatgattgagtcaaaggaggggggttatgatgacgaggtcatgatgaca
ccgaacatgcaaggtattatcatggcaataggtaaagccaggaatgtatatgacaggtgt
ggccctgaagcagggttctttaaggcaattaagttggaatattcaaggttggttaaattg
gctcaagaagacaccccaccagaaacagactatcgtttgcatcatgtagtggtctacttt
atccagaatcaggcaccaaagaaaatcattgagaaaacattgctagaacaatttgcagat
agaaatttgagtttcgatgaaaggtgtcacaacataatgaaagttgctcaagccaaaatt
gaaatgataaaacctgaagaagtaaacttggaggaatatgaggagtggcatcaggattat
aggaaatttagggaaacaaccatgtatctcataattgggctggaaaattttcaaagagaa
agttatatagattccttgctgttccttatctgtgcttatcagaataacaaagaactcttg
tccaaaggcccgcacagaggacatgatgaagaactgatatcacattatagaagagaatgt
ttgctcaaattaaatgaacaagctgcagaactgtttgaatctggagaggatcgtgaagta
aacaatggtctgattatcatgaatgagtttattgttccatttttgcccctgttattggtg
gatgaaatggaagagaaagatatacttgctgtggaagatatgagaaatcgatggtgttcc
tatcttgggcaagaaatggaatcaaacctccaagagaagctgacagattttctgccaaaa
ctgctggattgttctacggagattaaaggtttccacgagcctccgaaattacctccgtac
tccacacatgaactctgtgagcgatttacccgaatcatgttgtccctcagtcgaactcct
gctgatggaagataa

DBGET integrated database retrieval system