KEGG   Sus scrofa (pig): 100628105Help
Entry
100628105         CDS       T01009                                 

Gene name
USP25
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 25 isoform X5
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25 [EC:3.4.19.12]
Organism
ssc  Sus scrofa (pig)
Pathway
IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100628105 (USP25)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100628105 (USP25)
Peptidases [BR:ssc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100628105 (USP25)
Ubiquitin system [BR:ssc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100628105 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 903 aa AA seqDB search
MRELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMK
AEEETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAM
IEGEIESLHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYL
DRYMHRNREITRIKREEIKRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASS
KPVCTSPVDDIDASSPSSGSIPSQTLPSTTDQQGAPSSELPSTSPASIAAISSRSVIHKP
FTQSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMY
SDKSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRENRWMKYNDIAVTKSSWEELVRDSF
GGYRNASAYCLMYINDKPQFLIQEEFNKETGQALVGIETLPPDLRDFVEEDNQRFEKELE
EWDAQLAQKALQEKLLASQKLRESESSMTTAQAGEPEYLEQPSRSDFSKHLKEETIRIIT
KASHEHEDKSPETVLQSKPENTTSQPPSNQQVVEVAIPHVGKFMIESKEGGYDDEVMMTP
NMQGIIMAIGKARNVYDRCGPEAGFFKAIKLEYSRLVKLAQEDTPPETDYRLHHVVVYFI
QNQAPKKIIEKTLLEQFADRNLSFDERCHNIMKVAQAKIEMIKPEEVNLEEYEEWHQDYR
KFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKELLSKGPHRGHDEELISHYRRECL
LKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSY
LGQEMESNLQEKLTDFLPKLLDCSTEIKGFHEPPKLPPYSTHELCERFTRIMLSLSRTPA
DGR
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcttcggtatctgtttgcacttcttgttggtactaagaggaaatatgttgat
ccatcaagagcagttgaaattctcaaggatgctttcaaatcaaatgactcccagcagcaa
gacgtgagtgagtttacacacaaattattagattggttagaagatgccttccaaatgaaa
gctgaagaagagacggatgaagagaagccaaagaaccccatggtagagttgttctatgga
agattcctggctgtgggagtgcttgaaggtaaaaaatttgaaaatactgaaatgtttggt
cagtacccacttcaagtaaatggattcaaagatctacatgagtgcctagaagctgctatg
attgaaggagaaattgagtctttacattcagaaaattcaggaaaatccgggcaagagcat
tggtttactgaactaccgcctgtgttaacatttgagttgtcaagatttgaatttaatcag
gcattgggaagaccggaaaaaattcacaacaaattagaatttcctcaagttttatatctg
gacagatacatgcatagaaatagagaaataacaagaattaagagggaagaaatcaaaaga
ctaaaagattacctcacagtattacaacaaagactagaaaggtatttaagctatggttca
ggtcccaaacgattccccttggtagatgttctgcagtatgccttggaatttgcctcaagt
aaacccgtttgcacttctcctgttgatgatattgacgctagttccccatctagtggttcc
ataccatcacagacgttaccaagcacaacagatcagcagggagctccttcttcagagctg
ccaagcacatcgcctgcatcgatagctgccatttcatcgagatcagtaatacataaacca
ttcactcagtctcggatacctccagacttgcccatgcatccagcaccaaggcatataaca
gaagaagaactctctgtgctagaaagctgtttacatcgctggaggacagaaatagaaaat
gacaccagagatttgcaggaaagcatatccagaatccatcgcacaattgaactaatgtac
tctgacaaatctatgatacaggttccttatcgtttacatgctgttttagttcatgaaggc
caagctaatgccgggcactactgggcatacatttttgatcatcgtgaaaacaggtggatg
aagtacaatgatattgctgtaacaaaatcatcatgggaagagctagtgagggattccttt
ggtggttatagaaatgccagtgcatactgtttaatgtatataaatgataagccgcaattc
ttaatacaagaggagtttaataaagaaactgggcaggctcttgttggaatagaaacacta
ccaccggacttaagagattttgttgaggaagacaaccaacgatttgagaaagaactagaa
gaatgggacgcacagcttgcccagaaagctttgcaggaaaaacttttagcatctcagaaa
ttgagagagtcagagtcttctatgacaacagcacaagcaggagaaccagaatatctagag
cagccgtcaagaagtgatttctcaaagcacttgaaagaagaaactattcgaataattacc
aaggcatcacatgagcatgaagataaaagtcctgaaacagttttgcagtcgaaacctgaa
aataccacaagtcaaccaccttccaaccagcaagttgtagaggtggcgattcctcatgta
gggaaatttatgattgagtcaaaggaggggggttatgatgacgaggtcatgatgacaccg
aacatgcaaggtattatcatggcaataggtaaagccaggaatgtatatgacaggtgtggc
cctgaagcagggttctttaaggcaattaagttggaatattcaaggttggttaaattggct
caagaagacaccccaccagaaacagactatcgtttgcatcatgtagtggtctactttatc
cagaatcaggcaccaaagaaaatcattgagaaaacattgctagaacaatttgcagataga
aatttgagtttcgatgaaaggtgtcacaacataatgaaagttgctcaagccaaaattgaa
atgataaaacctgaagaagtaaacttggaggaatatgaggagtggcatcaggattatagg
aaatttagggaaacaaccatgtatctcataattgggctggaaaattttcaaagagaaagt
tatatagattccttgctgttccttatctgtgcttatcagaataacaaagaactcttgtcc
aaaggcccgcacagaggacatgatgaagaactgatatcacattatagaagagaatgtttg
ctcaaattaaatgaacaagctgcagaactgtttgaatctggagaggatcgtgaagtaaac
aatggtctgattatcatgaatgagtttattgttccatttttgcccctgttattggtggat
gaaatggaagagaaagatatacttgctgtggaagatatgagaaatcgatggtgttcctat
cttgggcaagaaatggaatcaaacctccaagagaagctgacagattttctgccaaaactg
ctggattgttctacggagattaaaggtttccacgagcctccgaaattacctccgtactcc
acacatgaactctgtgagcgatttacccgaatcatgttgtccctcagtcgaactcctgct
gatggaagataa

DBGET integrated database retrieval system